bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1979_orf1 Length=163 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_062380 elongation factor Tu, putative (EC:2.7.7.4);... 78.6 9e-15 pfa:MAL13P1.164 elongation factor Tu, putative; K02358 elongat... 71.6 1e-12 cel:Y71H2AM.23 tufm-1; TU elongation Factor (EF-Tu), Mitochond... 71.2 2e-12 ath:AT4G20360 ATRABE1B (ARABIDOPSIS RAB GTPASE HOMOLOG E1B); G... 70.1 3e-12 ath:AT4G02930 elongation factor Tu, putative / EF-Tu, putative... 69.7 5e-12 mmu:233870 Tufm, 2300002G02Rik, C76308, C76389, EF-TuMT, EFTU;... 67.4 2e-11 hsa:7284 TUFM, COXPD4, EF-TuMT, EFTU, P43; Tu translation elon... 67.0 2e-11 sce:YOR187W TUF1; Mitochondrial translation elongation factor ... 65.9 6e-11 bbo:BBOV_III001500 17.m07152; translation elongation factor Tu... 65.9 6e-11 tpv:TP03_0698 elongation factor Tu; K02358 elongation factor Tu 65.1 9e-11 dre:541378 tufm, D250, fi06f04, wu:fi06f04, zgc:110766; Tu tra... 64.7 1e-10 eco:b3980 tufB, ECK3971, JW3943, kirT, pulT; protein chain elo... 63.5 3e-10 eco:b3339 tufA, ECK3326, JW3301, kirT, pulT; protein chain elo... 63.5 3e-10 tgo:TGME49_102050 elongation factor Tu, putative (EC:2.7.7.4) 63.2 4e-10 tpv:TP05_0019 tufA; elongation factor Tu; K02358 elongation fa... 57.4 2e-08 bbo:BBOV_V000220 14.m00026; elongation factor Tu; K02358 elong... 53.9 2e-07 cel:C43E11.4 tufm-2; TU elongation Factor (EF-Tu), Mitochondri... 48.1 1e-05 cel:C47B2.7 selb-1; SELB (SelB homolog) translation factor for... 36.6 0.041 ath:AT4G18330 eukaryotic translation initiation factor 2 subun... 36.2 0.047 bbo:BBOV_IV007720 23.m05789; GTP binding protein; K06207 GTP-b... 36.2 0.050 sce:YER025W GCD11, SUI4; Gamma subunit of the translation init... 36.2 0.054 pfa:PFA_0495c selenocysteine-specific elongation factor SelB h... 35.8 0.057 xla:380257 eif2s3, MGC53362; eukaryotic translation initiation... 35.8 0.058 ath:AT1G04170 EIF2 GAMMA; translation factor, nucleic acid bin... 35.8 0.061 mmu:100039419 Gm2223; predicted pseudogene 2223 35.8 dre:327341 eif2s3, Su(var)3-9, fi03g03, wu:fi03g03, wu:fi37d04... 35.8 0.064 mmu:26908 Eif2s3y, Eif-2gy, Spy, Tfy; eukaryotic translation i... 35.8 0.065 tgo:TGME49_060170 elongation factor G, putative (EC:2.7.7.4); ... 35.8 0.069 eco:b3590 selB, ECK3579, fdhA, JW3563; selenocysteinyl-tRNA-sp... 35.8 0.072 mmu:26905 Eif2s3x, AA409828, AA547477, AI314668, Eif-2gx; euka... 35.8 0.072 hsa:1968 EIF2S3, EIF2, EIF2G, EIF2gamma, eIF-2gA; eukaryotic t... 35.8 0.072 ath:AT2G18720 GTP binding / GTPase/ serine-type peptidase/ tra... 35.4 0.082 pfa:PF14_0104 eukaryotic translation initiation factor 2 gamma... 35.0 0.10 cel:Y39G10AR.8 hypothetical protein; K03242 translation initia... 35.0 0.11 tgo:TGME49_107980 GTP-binding protein lepA, putative (EC:2.7.7... 34.3 0.17 tpv:TP01_0335 eukaryotic translation initiation factor 2 gamma... 34.3 0.18 tgo:TGME49_016960 elongation factor Tu GTP-binding domain-cont... 34.3 0.19 bbo:BBOV_IV004190 23.m06362; translation initiation factor 2 g... 34.3 0.20 pfa:PF11_0245 translation elongation factor EF-1, subunit alph... 33.9 0.25 cpv:cgd8_2930 Eft2p GTpase; translation elongation factor 2 (E... 33.9 0.26 cpv:cgd3_1650 eIF2G GTpase. eukaryotic translation initiation ... 33.5 0.30 pfa:PF14_0486 elongation factor 2; K03234 elongation factor 2 33.5 dre:259194 prc1a, MGC55982, cb212, prc1, prc1l, zgc:55982, zgc... 33.5 0.33 tgo:TGME49_035970 eukaryotic translation initiation factor 2 g... 33.1 0.44 dre:641497 eefsec, MGC123265, zgc:123265; eukaryotic elongatio... 33.1 0.46 xla:444045 eefsec, MGC82641; eukaryotic elongation factor, sel... 32.7 0.56 ath:AT5G39900 GTP binding / GTPase/ translation elongation factor 32.7 0.60 bbo:BBOV_IV004710 23.m06266; translation elongation factor G (... 32.0 0.82 hsa:60678 EEFSEC, EFSEC, SELB; eukaryotic elongation factor, s... 31.6 1.3 mmu:65967 Eefsec, Selb, sec; eukaryotic elongation factor, sel... 31.2 1.5 > tgo:TGME49_062380 elongation factor Tu, putative (EC:2.7.7.4); K02358 elongation factor Tu Length=552 Score = 78.6 bits (192), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 45/75 (60%), Positives = 49/75 (65%), Gaps = 7/75 (9%) Query 61 SLHS--FPVFSSVSSISSSPAARLCF-----SRGLAVGTFERLKPHLNIGTIGHVDHGKT 113 +LHS P FS+ S S A C RG AVG F+R KPHLNIGTIGHVDHGKT Sbjct 120 ALHSPVSPAFSTALSTSRVSALADCSRLLEPKRGFAVGVFQRTKPHLNIGTIGHVDHGKT 179 Query 114 TLTAAITKVLATSSK 128 TLTAAITKVLA + Sbjct 180 TLTAAITKVLADMGQ 194 > pfa:MAL13P1.164 elongation factor Tu, putative; K02358 elongation factor Tu Length=505 Score = 71.6 bits (174), Expect = 1e-12, Method: Composition-based stats. Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%) Query 84 FSRGLAVGTFERLKPHLNIGTIGHVDHGKTTLTAAITKV 122 F + A+G FER KPH+NIGTIGHVDHGKTTLTAAITKV Sbjct 106 FRQNFAIGIFERKKPHMNIGTIGHVDHGKTTLTAAITKV 144 > cel:Y71H2AM.23 tufm-1; TU elongation Factor (EF-Tu), Mitochondrial family member (tufm-1); K02358 elongation factor Tu Length=496 Score = 71.2 bits (173), Expect = 2e-12, Method: Composition-based stats. Identities = 41/76 (53%), Positives = 52/76 (68%), Gaps = 6/76 (7%) Query 85 SRGLAV----GTFERLKPHLNIGTIGHVDHGKTTLTAAITKVLATS--SKVRGALWLDTL 138 +R LAV F+R KPHLN+GTIGHVDHGKTTLT+AITK+LATS +K R +D Sbjct 32 ARHLAVPGGKAVFKRDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNA 91 Query 139 HKERFCFLVISAFKDE 154 +E+ + I+AF E Sbjct 92 PEEKARGITINAFHLE 107 > ath:AT4G20360 ATRABE1B (ARABIDOPSIS RAB GTPASE HOMOLOG E1B); GTP binding / GTPase/ translation elongation factor; K02358 elongation factor Tu Length=476 Score = 70.1 bits (170), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 47/110 (42%), Positives = 67/110 (60%), Gaps = 3/110 (2%) Query 42 SPSSSHSHSSRSRLPEVSSSLHSFPVFSSVSSISSSPAARLCFSRGLAVGTFERLKPHLN 101 SPS + S+ +L ++ S P +S +++ S+S + R F+ A G FER KPH+N Sbjct 23 SPSLCPAISTSGKLKTLTLSSSFLPSYS-LTTTSASQSTRRSFTVRAARGKFERKKPHVN 81 Query 102 IGTIGHVDHGKTTLTAAITKVLAT--SSKVRGALWLDTLHKERFCFLVIS 149 IGTIGHVDHGKTTLTAA+T LA+ SS + +D +ER + I+ Sbjct 82 IGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDEIDAAPEERARGITIN 131 > ath:AT4G02930 elongation factor Tu, putative / EF-Tu, putative; K02358 elongation factor Tu Length=454 Score = 69.7 bits (169), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 33/49 (67%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Query 92 TFERLKPHLNIGTIGHVDHGKTTLTAAITKVLATSSKVRGALWLDTLHK 140 TF R KPH+N+GTIGHVDHGKTTLTAAITKVLA K + A+ D + K Sbjct 60 TFTRNKPHVNVGTIGHVDHGKTTLTAAITKVLAEEGKAK-AIAFDEIDK 107 > mmu:233870 Tufm, 2300002G02Rik, C76308, C76389, EF-TuMT, EFTU; Tu translation elongation factor, mitochondrial; K02358 elongation factor Tu Length=435 Score = 67.4 bits (163), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 40/74 (54%), Positives = 50/74 (67%), Gaps = 7/74 (9%) Query 82 LCFSRGLAV---GTFERLKPHLNIGTIGHVDHGKTTLTAAITKVLAT--SSKVRGALWLD 136 LC RGLAV T+ R KPH+N+GTIGHVDHGKTTLTAAITK+LA +K + +D Sbjct 39 LC--RGLAVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEID 96 Query 137 TLHKERFCFLVISA 150 +ER + I+A Sbjct 97 NAPEERARGITINA 110 > hsa:7284 TUFM, COXPD4, EF-TuMT, EFTU, P43; Tu translation elongation factor, mitochondrial; K02358 elongation factor Tu Length=455 Score = 67.0 bits (162), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 38/70 (54%), Positives = 48/70 (68%), Gaps = 5/70 (7%) Query 86 RGLAV---GTFERLKPHLNIGTIGHVDHGKTTLTAAITKVLAT--SSKVRGALWLDTLHK 140 RGLAV T+ R KPH+N+GTIGHVDHGKTTLTAAITK+LA +K + +D + Sbjct 44 RGLAVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPE 103 Query 141 ERFCFLVISA 150 ER + I+A Sbjct 104 ERARGITINA 113 > sce:YOR187W TUF1; Mitochondrial translation elongation factor Tu; comprises both GTPase and guanine nucleotide exchange factor activities, while these activities are found in separate proteins in S. pombe and humans; K02358 elongation factor Tu Length=437 Score = 65.9 bits (159), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Query 93 FERLKPHLNIGTIGHVDHGKTTLTAAITKVLATSSKVRGALWLD 136 F+R KPH+NIGTIGHVDHGKTTLTAAITK LA GA +LD Sbjct 42 FDRSKPHVNIGTIGHVDHGKTTLTAAITKTLAAKG---GANFLD 82 > bbo:BBOV_III001500 17.m07152; translation elongation factor Tu; K02358 elongation factor Tu Length=473 Score = 65.9 bits (159), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 37/64 (57%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Query 60 SSLHSFPVFS-SVSSISSSPAARLCFSRGLAVGTFERLKPHLNIGTIGHVDHGKTTLTAA 118 SS S+ + S S ++SS + + R A+GTF R K HLNIGTIGHVDHGKTTLTAA Sbjct 50 SSDSSYGLLSWSFGNVSSMRGSIIGSRRYFAIGTFVRTKEHLNIGTIGHVDHGKTTLTAA 109 Query 119 ITKV 122 +TKV Sbjct 110 LTKV 113 > tpv:TP03_0698 elongation factor Tu; K02358 elongation factor Tu Length=445 Score = 65.1 bits (157), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%) Query 86 RGLAVGTFERLKPHLNIGTIGHVDHGKTTLTAAITKVLATSS 127 R A+GTF R K HLNIGTIGHVDHGKTTLTAA+TKV +++ Sbjct 49 RTFAIGTFVRTKEHLNIGTIGHVDHGKTTLTAALTKVCSSAG 90 > dre:541378 tufm, D250, fi06f04, wu:fi06f04, zgc:110766; Tu translation elongation factor, mitochondrial; K02358 elongation factor Tu Length=448 Score = 64.7 bits (156), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 30/35 (85%), Positives = 31/35 (88%), Gaps = 0/35 (0%) Query 93 FERLKPHLNIGTIGHVDHGKTTLTAAITKVLATSS 127 F R KPHLNIGTIGHVDHGKTTLTAAITKVLA + Sbjct 46 FARDKPHLNIGTIGHVDHGKTTLTAAITKVLAEAG 80 > eco:b3980 tufB, ECK3971, JW3943, kirT, pulT; protein chain elongation factor EF-Tu (duplicate of TufA); K02358 elongation factor Tu Length=394 Score = 63.5 bits (153), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%) Query 93 FERLKPHLNIGTIGHVDHGKTTLTAAITKVLATS 126 FER KPH+N+GTIGHVDHGKTTLTAAIT VLA + Sbjct 6 FERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKT 39 > eco:b3339 tufA, ECK3326, JW3301, kirT, pulT; protein chain elongation factor EF-Tu (duplicate of TufB); K02358 elongation factor Tu Length=394 Score = 63.5 bits (153), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%) Query 93 FERLKPHLNIGTIGHVDHGKTTLTAAITKVLATS 126 FER KPH+N+GTIGHVDHGKTTLTAAIT VLA + Sbjct 6 FERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKT 39 > tgo:TGME49_102050 elongation factor Tu, putative (EC:2.7.7.4) Length=401 Score = 63.2 bits (152), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%) Query 93 FERLKPHLNIGTIGHVDHGKTTLTAAITKVLATSSKVR 130 F++ KPH+NIGTIGHVDHGKTTLTAAIT VLA +++ + Sbjct 6 FKKQKPHINIGTIGHVDHGKTTLTAAITYVLAKNNQAK 43 > tpv:TP05_0019 tufA; elongation factor Tu; K02358 elongation factor Tu Length=411 Score = 57.4 bits (137), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 26/31 (83%), Positives = 28/31 (90%), Gaps = 0/31 (0%) Query 93 FERLKPHLNIGTIGHVDHGKTTLTAAITKVL 123 F R KPH+NIGTIGHVDHGKTTLT+AIT VL Sbjct 6 FLRNKPHVNIGTIGHVDHGKTTLTSAITSVL 36 > bbo:BBOV_V000220 14.m00026; elongation factor Tu; K02358 elongation factor Tu Length=410 Score = 53.9 bits (128), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 23/36 (63%), Positives = 30/36 (83%), Gaps = 0/36 (0%) Query 88 LAVGTFERLKPHLNIGTIGHVDHGKTTLTAAITKVL 123 +A + + KPH+NIGTIGH+DHGKTTLT+A+T VL Sbjct 1 MAKEQYIKNKPHINIGTIGHIDHGKTTLTSALTSVL 36 > cel:C43E11.4 tufm-2; TU elongation Factor (EF-Tu), Mitochondrial family member (tufm-2); K02358 elongation factor Tu Length=439 Score = 48.1 bits (113), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 20/28 (71%), Positives = 26/28 (92%), Gaps = 0/28 (0%) Query 97 KPHLNIGTIGHVDHGKTTLTAAITKVLA 124 K ++N+GTIGH+DHGKTTLT+AIT+V A Sbjct 43 KINVNVGTIGHIDHGKTTLTSAITRVQA 70 > cel:C47B2.7 selb-1; SELB (SelB homolog) translation factor for selenocysteine incorporation family member (selb-1) Length=500 Score = 36.6 bits (83), Expect = 0.041, Method: Compositional matrix adjust. Identities = 16/28 (57%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKVLATSS 127 LN+G +GHVD GKTTLT I ++ +TS+ Sbjct 14 LNLGILGHVDSGKTTLTRRIAELGSTSA 41 > ath:AT4G18330 eukaryotic translation initiation factor 2 subunit 3, putative / eIF2S3, putative / eIF-2-gamma, putative Length=284 Score = 36.2 bits (82), Expect = 0.047, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 40 INIGTIGHVAHGKSTIVKAISGV 62 > bbo:BBOV_IV007720 23.m05789; GTP binding protein; K06207 GTP-binding protein Length=627 Score = 36.2 bits (82), Expect = 0.050, Method: Composition-based stats. Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 10/81 (12%) Query 62 LHSFPVFSSVSSISSSPAARLCFSRGLAVGTFERLKPHLNIGTIGHVDHGKTTLTAAITK 121 H+ +F+ ++ ++ P + CF R R NI + HVDHGKTTL + + Sbjct 3 FHTCRLFTHLTRLALRPES--CFHR--------RFSYIRNIAVVAHVDHGKTTLVDGLLR 52 Query 122 VLATSSKVRGALWLDTLHKER 142 + AL + L KER Sbjct 53 CSGETLTHSRALDSNELEKER 73 > sce:YER025W GCD11, SUI4; Gamma subunit of the translation initiation factor eIF2, involved in the identification of the start codon; binds GTP when forming the ternary complex with GTP and tRNAi-Met; K03242 translation initiation factor 2 subunit 3 Length=527 Score = 36.2 bits (82), Expect = 0.054, Method: Composition-based stats. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 101 INIGTIGHVAHGKSTVVRAISGV 123 > pfa:PFA_0495c selenocysteine-specific elongation factor SelB homologue, putative Length=934 Score = 35.8 bits (81), Expect = 0.057, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 7/40 (17%) Query 99 HLNIGTIGHVDHGKTTLTAAITKVLAT-------SSKVRG 131 ++N+G +GHVD GKT+L +++VL+T SK RG Sbjct 3 NINVGVLGHVDSGKTSLCKCLSQVLSTCALDKHKESKERG 42 > xla:380257 eif2s3, MGC53362; eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa; K03242 translation initiation factor 2 subunit 3 Length=472 Score = 35.8 bits (81), Expect = 0.058, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 42 INIGTIGHVAHGKSTVVKAISGV 64 > ath:AT1G04170 EIF2 GAMMA; translation factor, nucleic acid binding / translation initiation factor; K03242 translation initiation factor 2 subunit 3 Length=465 Score = 35.8 bits (81), Expect = 0.061, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 34 INIGTIGHVAHGKSTVVKAISGV 56 > mmu:100039419 Gm2223; predicted pseudogene 2223 Length=475 Score = 35.8 bits (81), Expect = 0.061, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 45 INIGTIGHVAHGKSTVVKAISGV 67 > dre:327341 eif2s3, Su(var)3-9, fi03g03, wu:fi03g03, wu:fi37d04, zgc:63805; eukaryotic translation initiation factor 2, subunit 3 gamma; K03242 translation initiation factor 2 subunit 3 Length=472 Score = 35.8 bits (81), Expect = 0.064, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 42 INIGTIGHVAHGKSTVVKAISGV 64 > mmu:26908 Eif2s3y, Eif-2gy, Spy, Tfy; eukaryotic translation initiation factor 2, subunit 3, structural gene Y-linked; K03242 translation initiation factor 2 subunit 3 Length=472 Score = 35.8 bits (81), Expect = 0.065, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 42 INIGTIGHVAHGKSTVVKAISGV 64 > tgo:TGME49_060170 elongation factor G, putative (EC:2.7.7.4); K02355 elongation factor G Length=877 Score = 35.8 bits (81), Expect = 0.069, Method: Composition-based stats. Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 7/71 (9%) Query 79 AARLCFSRGLAVGTFERLKPHLNIGTIGHVDHGKTTLTAAI---TKVLATSSKVRGA--- 132 AA L R + G E ++ NIG H+D GKTTLT I T +A +VRG+ Sbjct 133 AASLSHRRSFSSGHPEHMRFLRNIGISAHIDSGKTTLTERILFYTGRIAAIHEVRGSDGV 192 Query 133 -LWLDTLHKER 142 +D++ ER Sbjct 193 GAKMDSMELER 203 > eco:b3590 selB, ECK3579, fdhA, JW3563; selenocysteinyl-tRNA-specific translation factor; K03833 selenocysteine-specific elongation factor Length=614 Score = 35.8 bits (81), Expect = 0.072, Method: Composition-based stats. Identities = 17/23 (73%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 102 IGTIGHVDHGKTTLTAAITKVLA 124 I T GHVDHGKTTL AIT V A Sbjct 3 IATAGHVDHGKTTLLQAITGVNA 25 > mmu:26905 Eif2s3x, AA409828, AA547477, AI314668, Eif-2gx; eukaryotic translation initiation factor 2, subunit 3, structural gene X-linked; K03242 translation initiation factor 2 subunit 3 Length=472 Score = 35.8 bits (81), Expect = 0.072, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 42 INIGTIGHVAHGKSTVVKAISGV 64 > hsa:1968 EIF2S3, EIF2, EIF2G, EIF2gamma, eIF-2gA; eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa; K03242 translation initiation factor 2 subunit 3 Length=472 Score = 35.8 bits (81), Expect = 0.072, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ AI+ V Sbjct 42 INIGTIGHVAHGKSTVVKAISGV 64 > ath:AT2G18720 GTP binding / GTPase/ serine-type peptidase/ translation factor, nucleic acid binding; K03242 translation initiation factor 2 subunit 3 Length=470 Score = 35.4 bits (80), Expect = 0.082, Method: Compositional matrix adjust. Identities = 14/23 (60%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ A++ V Sbjct 39 INIGTIGHVAHGKSTIVKAVSGV 61 > pfa:PF14_0104 eukaryotic translation initiation factor 2 gamma subunit, putative; K03242 translation initiation factor 2 subunit 3 Length=465 Score = 35.0 bits (79), Expect = 0.10, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +N+GTIGHV HGK+TL AI+ V Sbjct 36 INLGTIGHVAHGKSTLVHAISGV 58 > cel:Y39G10AR.8 hypothetical protein; K03242 translation initiation factor 2 subunit 3 Length=469 Score = 35.0 bits (79), Expect = 0.11, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+TL A + V Sbjct 41 INIGTIGHVAHGKSTLVKAFSGV 63 > tgo:TGME49_107980 GTP-binding protein lepA, putative (EC:2.7.7.4); K03596 GTP-binding protein LepA Length=638 Score = 34.3 bits (77), Expect = 0.17, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 0/41 (0%) Query 101 NIGTIGHVDHGKTTLTAAITKVLATSSKVRGALWLDTLHKE 141 N I H+DHGK+TL+ + ++ T S+ A +LD+L E Sbjct 36 NFSIIAHIDHGKSTLSDRLLELTGTISQGAKAQFLDSLEVE 76 > tpv:TP01_0335 eukaryotic translation initiation factor 2 gamma subunit; K03242 translation initiation factor 2 subunit 3 Length=462 Score = 34.3 bits (77), Expect = 0.18, Method: Compositional matrix adjust. Identities = 14/23 (60%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +NIGTIGHV HGK+T+ A++ V Sbjct 36 INIGTIGHVAHGKSTVVKALSGV 58 > tgo:TGME49_016960 elongation factor Tu GTP-binding domain-containing protein (EC:2.7.7.4) Length=863 Score = 34.3 bits (77), Expect = 0.19, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 99 HLNIGTIGHVDHGKTTLTAAITKVLATSS 127 + N+G +GHVD GKT+L +T V +T+S Sbjct 13 YANVGVLGHVDSGKTSLARVLTAVRSTAS 41 > bbo:BBOV_IV004190 23.m06362; translation initiation factor 2 gamma subunit; K03242 translation initiation factor 2 subunit 3 Length=467 Score = 34.3 bits (77), Expect = 0.20, Method: Compositional matrix adjust. Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 7/42 (16%) Query 88 LAVGTFERLKPH-------LNIGTIGHVDHGKTTLTAAITKV 122 L V T L P +NIGTIGHV HGK+T+ A++ V Sbjct 19 LDVSTLTSLSPEVISRQATINIGTIGHVAHGKSTVVHALSGV 60 > pfa:PF11_0245 translation elongation factor EF-1, subunit alpha, putative; K03267 peptide chain release factor subunit 3 Length=555 Score = 33.9 bits (76), Expect = 0.25, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 97 KPHLNIGTIGHVDHGKTTLTAAITKVLA 124 +PHLNI IGHVD GK+T I +L Sbjct 117 RPHLNIIFIGHVDAGKSTACGNILYILG 144 > cpv:cgd8_2930 Eft2p GTpase; translation elongation factor 2 (EF-2) ; K03234 elongation factor 2 Length=836 Score = 33.9 bits (76), Expect = 0.26, Method: Composition-based stats. Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query 97 KPH--LNIGTIGHVDHGKTTLT-AAITKVLATSSKVRG-ALWLDTLHKER 142 KPH N+ I HVDHGK+TLT + + K +SK G A + DT E+ Sbjct 19 KPHNIRNMSVIAHVDHGKSTLTDSLVCKAGIIASKAAGDARFTDTRADEQ 68 > cpv:cgd3_1650 eIF2G GTpase. eukaryotic translation initiation factor 2 gamma subunit (ZnR+GTpase) ; K03242 translation initiation factor 2 subunit 3 Length=474 Score = 33.5 bits (75), Expect = 0.30, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +N+GTIGHV HGK+T+ A++ V Sbjct 44 INLGTIGHVAHGKSTVVRAVSGV 66 > pfa:PF14_0486 elongation factor 2; K03234 elongation factor 2 Length=832 Score = 33.5 bits (75), Expect = 0.33, Method: Composition-based stats. Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Query 101 NIGTIGHVDHGKTTLT-AAITKVLATSSKVRG-ALWLDTLHKER 142 N+ I HVDHGK+TLT + ++K SSK G A + DT E+ Sbjct 21 NMSVIAHVDHGKSTLTDSLVSKAGIISSKNAGDARFTDTRQDEQ 64 > dre:259194 prc1a, MGC55982, cb212, prc1, prc1l, zgc:55982, zgc:86918; protein regulator of cytokinesis 1a Length=598 Score = 33.5 bits (75), Expect = 0.33, Method: Composition-based stats. Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 13/115 (11%) Query 6 VKTLKAETAALLFSAMRRPQKCRRLSPCPAP--TKEISSPSSSHSHSSRSRLPEVSSSLH 63 +K +K LL+ + R RR++ P P T++++S SS S + + L + SS Sbjct 452 MKKIKQTEEDLLYGTVIRTPTKRRIAGTPTPGKTRKLTSASSMCSSTPNTTLRSICSSPS 511 Query 64 SFPVFSSVSSISSSPAARLCFSRGLAVGTFERLKPHLNIGTIGHVDHGKTTLTAA 118 P SS + +PA RG ER K +L+ H+ T+TA+ Sbjct 512 MRPPLSSSKLNARTPA------RGRTPRGLERNKENLS-----HLSGALRTMTAS 555 > tgo:TGME49_035970 eukaryotic translation initiation factor 2 gamma subunit, putative (EC:2.7.7.4); K03242 translation initiation factor 2 subunit 3 Length=465 Score = 33.1 bits (74), Expect = 0.44, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 0/23 (0%) Query 100 LNIGTIGHVDHGKTTLTAAITKV 122 +N GTIGHV HGK+T+ A++ V Sbjct 36 INFGTIGHVAHGKSTIVRAVSGV 58 > dre:641497 eefsec, MGC123265, zgc:123265; eukaryotic elongation factor, selenocysteine-tRNA-specific Length=576 Score = 33.1 bits (74), Expect = 0.46, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 99 HLNIGTIGHVDHGKTTLTAAITKVLATSS 127 + N+G +GHVD GKT+L A++ +T++ Sbjct 9 NFNVGVLGHVDSGKTSLARALSSTASTAA 37 > xla:444045 eefsec, MGC82641; eukaryotic elongation factor, selenocysteine-tRNA-specific Length=575 Score = 32.7 bits (73), Expect = 0.56, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 99 HLNIGTIGHVDHGKTTLTAAITKVLATSS 127 + N+G +GH+D GKT+L A++ +T++ Sbjct 9 NFNVGVLGHIDSGKTSLAKALSTTASTAA 37 > ath:AT5G39900 GTP binding / GTPase/ translation elongation factor Length=663 Score = 32.7 bits (73), Expect = 0.60, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query 101 NIGTIGHVDHGKTTLTAAITKVLATSSKVRGA-LWLDTLHKER 142 N I H+DHGK+TL + ++ T K G +LD L ER Sbjct 68 NFSIIAHIDHGKSTLADRLMELTGTIKKGHGQPQYLDKLQVER 110 > bbo:BBOV_IV004710 23.m06266; translation elongation factor G (EF-G); K02355 elongation factor G Length=817 Score = 32.0 bits (71), Expect = 0.82, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Query 96 LKPHLNIGTIGHVDHGKTTLTAAITKVLATSSKV----RGALWLDTLHKERFCFLVISA 150 L + NIG I H+D GKTT T + + S K+ G +D + +ER + I+A Sbjct 85 LNRYRNIGIIAHIDAGKTTTTERVLYLTGVSFKIGEVHDGEAIMDYMPQERERGITITA 143 > hsa:60678 EEFSEC, EFSEC, SELB; eukaryotic elongation factor, selenocysteine-tRNA-specific Length=596 Score = 31.6 bits (70), Expect = 1.3, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 99 HLNIGTIGHVDHGKTTLTAAITKVLATSS 127 ++N+G +GH+D GKT L A++ +T++ Sbjct 7 NVNVGVLGHIDSGKTALARALSTTASTAA 35 > mmu:65967 Eefsec, Selb, sec; eukaryotic elongation factor, selenocysteine-tRNA-specific Length=583 Score = 31.2 bits (69), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 99 HLNIGTIGHVDHGKTTLTAAITKVLATSS 127 ++N+G +GH+D GKT L A++ +T++ Sbjct 7 NVNVGVLGHIDSGKTALARALSTTASTAA 35 Lambda K H 0.320 0.129 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3832864436 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40