bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1586_orf2 Length=154 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_022720 glycogen synthase, putative (EC:2.4.1.21); K... 155 3e-38 ath:AT3G01180 AtSS2; AtSS2 (starch synthase 2); transferase, t... 58.2 1e-08 ath:AT4G18240 ATSS4; ATSS4; transferase, transferring glycosyl... 48.1 1e-05 eco:b3429 glgA, ECK3415, JW3392; glycogen synthase (EC:2.4.1.2... 44.3 1e-04 ath:AT1G11720 ATSS3; ATSS3 (starch synthase 3); starch synthas... 43.5 3e-04 ath:AT1G32900 starch synthase, putative; K13679 granule-bound ... 43.1 4e-04 ath:AT5G24300 SSI1; SSI1 (SUPPRESSOR OF SALICYLIC ACID INSENSI... 40.0 0.003 ath:AT5G01220 SQD2; SQD2 (sulfoquinovosyldiacylglycerol 2); UD... 35.4 0.080 tgo:TGME49_009960 glycan synthetase, putative (EC:2.4.1.21 2.4... 33.9 0.20 cpv:cgd5_3140 LPS glycosyltransferase of possible cyanobacteri... 32.3 0.69 mmu:238057 Gdf7, BMP12; growth differentiation factor 7; K0466... 30.4 2.3 > tgo:TGME49_022720 glycogen synthase, putative (EC:2.4.1.21); K00703 starch synthase [EC:2.4.1.21] Length=1350 Score = 155 bits (393), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 83/134 (61%), Positives = 92/134 (68%), Gaps = 12/134 (8%) Query 32 PAEFLGRPNEFFTKGAHVNYGADFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKDTV 91 P F P EFF GA VN GADFGLMPS FEPGGIVQHEFFI+GTPV+AF TGGLKDTV Sbjct 1044 PHSFWADPGEFFCNGALVNLGADFGLMPSLFEPGGIVQHEFFIAGTPVVAFRTGGLKDTV 1103 Query 92 VE--FVPAAGTG----------NGFSFMNYTSGDLLYAMERAIRVFDDKEKYTLLRQLAR 139 E P G G NGF+F YT+GD L+A+ERA+RVF D+ KY LR AR Sbjct 1104 REGSVTPGLGGGKISVESARQNNGFTFDAYTAGDFLFAIERALRVFSDRAKYEQLRANAR 1163 Query 140 QSVVSCECSSWAWL 153 SVVSCE S+ AWL Sbjct 1164 ASVVSCEESARAWL 1177 > ath:AT3G01180 AtSS2; AtSS2 (starch synthase 2); transferase, transferring glycosyl groups; K00703 starch synthase [EC:2.4.1.21] Length=792 Score = 58.2 bits (139), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Query 42 FFTKGAH-VNYGADFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKDTVVEFVPAAGT 100 F K AH + GAD LMPS FEP G+ Q GT + GGL+DTV +F P + T Sbjct 669 FSVKTAHRITAGADILLMPSRFEPCGLNQLYAMNYGTIPVVHAVGGLRDTVQQFDPYSET 728 Query 101 GNGFSFMNYTSGDLLYAM 118 G G++F + +G L++A+ Sbjct 729 GLGWTFDSAEAGKLIHAL 746 > ath:AT4G18240 ATSS4; ATSS4; transferase, transferring glycosyl groups (EC:2.4.1.21) Length=1040 Score = 48.1 bits (113), Expect = 1e-05, Method: Composition-based stats. Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 7/94 (7%) Query 47 AHVNYGA-DFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKDTVVEF----VPAAGTG 101 +H Y A D ++PS FEP G+ Q G+ IA TGGL D+V + +P Sbjct 912 SHTIYAASDLFIIPSIFEPCGLTQMIAMRYGSIPIARKTGGLNDSVFDIDDDTIPTQFQ- 970 Query 102 NGFSFMNYTSGDLLYAMERAIRVF-DDKEKYTLL 134 NGF+F YA+ERA + D+EK+ L Sbjct 971 NGFTFQTADEQGFNYALERAFNHYKKDEEKWMRL 1004 > eco:b3429 glgA, ECK3415, JW3392; glycogen synthase (EC:2.4.1.21); K00703 starch synthase [EC:2.4.1.21] Length=477 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 6/94 (6%) Query 52 GADFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKDTVVEFV---PAAGTGNGFSFMN 108 GAD L+PS FEP G+ Q GT + TGGL DTV + A G +GF F + Sbjct 366 GADVILVPSRFEPCGLTQLYGLKYGTLPLVRRTGGLADTVSDCSLENLADGVASGFVFED 425 Query 109 YTSGDLLYAMERAIRVFDDKEKYTLLRQLARQSV 142 + LL A+ RA ++ + +L R + RQ++ Sbjct 426 SNAWSLLRAIRRAFVLW---SRPSLWRFVQRQAM 456 > ath:AT1G11720 ATSS3; ATSS3 (starch synthase 3); starch synthase/ transferase, transferring glycosyl groups (EC:2.4.1.21) Length=1025 Score = 43.5 bits (101), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 37/116 (31%), Positives = 53/116 (45%), Gaps = 18/116 (15%) Query 47 AHVNY-GADFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKDTVVEFVPAAGTG---- 101 +H+ Y GADF L+PS FEP G+ Q G + TGGL DTV + Sbjct 902 SHLIYAGADFILVPSIFEPCGLTQLIAMRYGAVPVVRKTGGLFDTVFDVDHDKERAQAQV 961 Query 102 ---NGFSFMNYTSGDLLYAMERAIRVFDDKEKY--TLLRQLARQSVVSCECSSWAW 152 NGFSF + + YA+ RAI + D ++ +L + + Q W+W Sbjct 962 LEPNGFSFDGADAPGVDYALNRAISAWYDGREWFNSLCKTVMEQ--------DWSW 1009 > ath:AT1G32900 starch synthase, putative; K13679 granule-bound starch synthase [EC:2.4.1.242] Length=610 Score = 43.1 bits (100), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 4/75 (5%) Query 21 RYKDDGAAVEIPAEFLGRP---NEFFTKGAH-VNYGADFGLMPSAFEPGGIVQHEFFISG 76 + K + +E+ +F G+ +F AH + GADF ++PS FEP G++Q G Sbjct 440 KKKMEAQILELEEKFPGKAVGVAKFNVPLAHMITAGADFIIVPSRFEPCGLIQLHAMRYG 499 Query 77 TPVIAFHTGGLKDTV 91 T I TGGL DTV Sbjct 500 TVPIVASTGGLVDTV 514 > ath:AT5G24300 SSI1; SSI1 (SUPPRESSOR OF SALICYLIC ACID INSENSITIVITY 1); starch synthase/ transferase, transferring glycosyl groups; K00703 starch synthase [EC:2.4.1.21] Length=652 Score = 40.0 bits (92), Expect = 0.003, Method: Compositional matrix adjust. Identities = 22/48 (45%), Positives = 26/48 (54%), Gaps = 0/48 (0%) Query 49 VNYGADFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKDTVVEFVP 96 + G D LMPS FEP G+ Q GT + TGGL+DTV F P Sbjct 529 ITAGCDILLMPSRFEPCGLNQLYAMRYGTIPVVHGTGGLRDTVENFNP 576 > ath:AT5G01220 SQD2; SQD2 (sulfoquinovosyldiacylglycerol 2); UDP-glycosyltransferase/ UDP-sulfoquinovose:DAG sulfoquinovosyltransferase/ transferase, transferring glycosyl groups; K06119 sulfoquinovosyltransferase [EC:2.4.1.-] Length=510 Score = 35.4 bits (80), Expect = 0.080, Method: Compositional matrix adjust. Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 13/100 (13%) Query 54 DFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKDTVVEFVPAAGTGN-GFSFMNYTSG 112 D +MPS E G+V E SG PV+A GG+ D +P G GF F G Sbjct 378 DVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPD----IIPEDQEGKTGFLF---NPG 430 Query 113 DLLYAMERAIRVFDDKEKYTLLRQLARQSVVSCECSSWAW 152 D+ + + + D+E ++ + AR+ E + W Sbjct 431 DVEDCVTKLRTLLHDRETREIIGKAARE-----ETEKYDW 465 > tgo:TGME49_009960 glycan synthetase, putative (EC:2.4.1.21 2.4.1.18) Length=1707 Score = 33.9 bits (76), Expect = 0.20, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 0/38 (0%) Query 54 DFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKDTV 91 D ++PS EP GIV E + SG PV+A ++GG +D V Sbjct 1343 DAVVVPSRNEPFGIVVLEAWSSGKPVVATNSGGPRDFV 1380 > cpv:cgd5_3140 LPS glycosyltransferase of possible cyanobacterial origin Length=2069 Score = 32.3 bits (72), Expect = 0.69, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 54 DFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKD 89 D ++PS EP GIV E + +G PV+A +GG +D Sbjct 1537 DAVVVPSRNEPFGIVVLEGWTAGKPVVATTSGGPRD 1572 > mmu:238057 Gdf7, BMP12; growth differentiation factor 7; K04664 growth differentiation factor 5/6/7 Length=453 Score = 30.4 bits (67), Expect = 2.3, Method: Compositional matrix adjust. Identities = 25/91 (27%), Positives = 35/91 (38%), Gaps = 13/91 (14%) Query 60 SAFEPGGIVQHEFFIS-------GTPVIAFHTGGLKDTVVEFVPAAGTGNGFSFMNYTSG 112 S F G +V H F +S PV A G DT+ F A G F F + Sbjct 75 SGFRNGSVVPHHFMMSLYRSLAGRAPVAAASGHGRVDTITGFTDQATQGQSFLFDVSSLS 134 Query 113 DLLYAMERAIRVF------DDKEKYTLLRQL 137 + + +RV D++ TLL +L Sbjct 135 EADEVVNAELRVLRRRSPEPDRDSATLLPRL 165 Lambda K H 0.323 0.139 0.446 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3321543300 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40