bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3146_orf1 Length=113 Score E Sequences producing significant alignments: (Bits) Value CE09101 34.3 0.062 7291160 32.0 0.29 CE12220 30.4 0.95 At5g62510 29.6 1.6 Hs22043508 29.3 1.6 Hs9790173 28.9 2.6 At5g04130 28.1 4.3 At5g17070 27.7 4.8 > CE09101 Length=378 Score = 34.3 bits (77), Expect = 0.062, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 5/54 (9%) Query 11 FAWERARDYLFALVLSFTAPPITLQRLCEVVLKPPHRELEKFYFIIRKLLRVRD 64 F+ E + +++ + SF P T QRLCE++++P + Y I K LR D Sbjct 155 FSTEESMEFVLSKAKSFDGFPFTWQRLCELLIEP-----MRHYNTIDKFLRAVD 203 > 7291160 Length=606 Score = 32.0 bits (71), Expect = 0.29, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Query 11 FAWERARDYLFALVLSFTAPPITLQRLCEVVLKPPHRELEKFYFIIRKLLR 61 F +E + L + F A P T+QRLCE+++ P K Y I K +R Sbjct 80 FNYETMKSSLLERLDLFNAAPFTVQRLCELLIDP-----RKQYSRIDKFMR 125 > CE12220 Length=170 Score = 30.4 bits (67), Expect = 0.95, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Query 55 IIRKLLRVRDCSDEAPLRVLFPLDSSLSQRLAEANAVSEKLRNASAALF 103 II+ LL + EA +++ D +LSQR A NA+ +K +A + L+ Sbjct 106 IIKNLL----AAHEATMKIFDNKDQTLSQREAAVNALKKKYPHAPSTLY 150 > At5g62510 Length=420 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 8/54 (14%) Query 27 FTAPPITLQRLCEVVLKPPHRELEKFYFIIRK---LLRVRDCSDE-----APLR 72 F AP I L L E++ + PH+ L +F + ++ L+R R S+ +PLR Sbjct 39 FVAPEIPLDLLIEILTRLPHKSLMRFKCVSKQWSSLIRSRFFSNRYLTVASPLR 92 > Hs22043508 Length=417 Score = 29.3 bits (64), Expect = 1.6, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query 13 WERARDYLFALVLSFTAPPITLQRLCEVVLKP--PHRELEKFYFIIRKLLRVRDC 65 ++ ++ + +V F P T+QRLCE++ P + +KF + K + V C Sbjct 80 FDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSC 134 > Hs9790173 Length=453 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 13 WERARDYLFALVLSFTAPPITLQRLCEVVLKP 44 ++ ++ + +V F P T+QRLCE++ P Sbjct 158 FDEMKERILKIVTGFNGIPFTIQRLCELLTDP 189 > At5g04130 Length=760 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 72 RVLFPLDSSLSQRLAEANAVSEKLRNASAA 101 R+ F L S LSQRL + NA+S + + A+ Sbjct 51 RLKFQLTSVLSQRLIQRNAISSRFLSTEAS 80 > At5g17070 Length=254 Score = 27.7 bits (60), Expect = 4.8, Method: Compositional matrix adjust. Identities = 10/14 (71%), Positives = 12/14 (85%), Gaps = 0/14 (0%) Query 29 APPITLQRLCEVVL 42 PP TLQRLCE++L Sbjct 132 GPPFTLQRLCEILL 145 Lambda K H 0.326 0.140 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1185472426 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40