bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3015_orf2 Length=77 Score E Sequences producing significant alignments: (Bits) Value At5g42740 42.0 3e-04 YBR196c 33.5 0.087 SPBC1604.05 29.6 1.4 Hs20560659 28.1 4.2 7303982 27.7 5.5 YOR177c 26.9 9.3 > At5g42740 Length=560 Score = 42.0 bits (97), Expect = 3e-04, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 0/47 (0%) Query 30 LRELMQDEERNARMYREFGGVCMDFSRQLLDKEGLDALIELAKERRV 76 LR+LM D R M EF G+ +D+SRQ E +D L+ LAK ++ Sbjct 29 LRDLMSDANRCQSMMMEFDGLLLDYSRQRATVETMDKLLNLAKASQL 75 > YBR196c Length=554 Score = 33.5 bits (75), Expect = 0.087, Method: Composition-based stats. Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 6/77 (7%) Query 6 KMSSEFLSTKSVGLLQQQKGLNNSLR-ELMQDEERNARMYREF-----GGVCMDFSRQLL 59 K+++E + + + + +G S++ E +D +R ++ + F + D+S+ L+ Sbjct 10 KLATELPAWSKLQKIYESQGKTLSVKQEFQKDAKRFEKLNKTFTNYDGSKILFDYSKNLV 69 Query 60 DKEGLDALIELAKERRV 76 + E + ALIELAKE V Sbjct 70 NDEIIAALIELAKEANV 86 > SPBC1604.05 Length=550 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 0/34 (0%) Query 43 MYREFGGVCMDFSRQLLDKEGLDALIELAKERRV 76 + E G + DFS+ L+ +E ++ L++LAKE V Sbjct 49 LKEEDGPILFDFSKNLITEETVELLVKLAKEANV 82 > Hs20560659 Length=987 Score = 28.1 bits (61), Expect = 4.2, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 23 QKGLNNSLRELMQDEERNARMYREFGGV 50 Q+ L R+L+++EE+NAR+ +E G V Sbjct 662 QQELRTVKRKLLEEEEKNARLQKELGDV 689 > 7303982 Length=558 Score = 27.7 bits (60), Expect = 5.5, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Query 24 KGLNNSLREL-MQDEER----NARMYREFGG-VCMDFSRQLLDKEGLDALIELAKERRV 76 KG + ++++L ++D +R + R++ + G + +D+S+ ++ E D L+ LAK RRV Sbjct 24 KGKDLNIKDLFVKDSKRFSKYSLRLHTQNDGEILLDYSKNRINDEVWDLLLTLAKVRRV 82 > YOR177c Length=464 Score = 26.9 bits (58), Expect = 9.3, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Query 16 SVGLLQQQ----KGLNNSLR-ELMQDEERNARMYREFGGVCMDFSRQLLDKE 62 S+ LQQQ K NN LR + + +ER R+ EF + D+S+Q+ KE Sbjct 231 SINSLQQQLLEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKE 282 Lambda K H 0.317 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175087368 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40