bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2668_orf2 Length=162 Score E Sequences producing significant alignments: (Bits) Value CE20741 46.6 2e-05 At1g03140 46.6 2e-05 Hs4506123 36.6 0.022 CE05372 32.0 0.51 7300471 32.0 0.57 7298625 31.6 0.67 At2g41500 31.6 0.75 Hs4758558 31.6 0.79 SPCC126.14 31.2 1.0 7298384 28.1 8.5 YMR294w 27.7 9.3 Hs14747970 27.7 9.8 > CE20741 Length=348 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 50/154 (32%), Positives = 77/154 (50%), Gaps = 23/154 (14%) Query 4 IAKQKQQINEL-PKAGPGKYILQKDLQQKLREQKDREQEETANKKRKTELQQLAELQERL 62 +AK+++ ++ + K G K++ DL+ K ++ +R+Q+E A+KKRK + + L E R Sbjct 11 MAKKRKAVSGMEVKEGNAKFVKGADLEMKRNQEYERKQQEIASKKRKVDDEILQESSSRT 70 Query 63 KARAFQPHSSEAEATVADAGDTAEGREEELVPPVDLPEIFRRLRRLKQPISLFGETPWKR 122 K P E E+ + +E P + EI RLR+ PI LFGET Sbjct 71 K-----PAPVENESEI-----------DEKTP---MSEIQTRLRQRNHPIMLFGETDIDV 111 Query 123 YDRLCKLELQAIDDETTEGQKNVFH-AMQREGEE 155 RL +LEL D EG +N AM+ G+E Sbjct 112 RKRLHQLELAQPD--LNEGWENELQTAMKVIGKE 143 > At1g03140 Length=420 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 29/61 (47%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Query 89 EEELVPPVDLPEIFRRLRRLKQPISLFGETPWKRYDRL---CKLELQAIDDETTEGQKNV 145 +E L+ P E+ RRLR LKQP++LFGE R DRL K L +D + TEGQ N Sbjct 99 DENLILPRQ--EVIRRLRFLKQPMTLFGEDDQSRLDRLKYVLKEGLFEVDSDMTEGQTND 156 Query 146 F 146 F Sbjct 157 F 157 > Hs4506123 Length=342 Score = 36.6 bits (83), Expect = 0.022, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Query 100 EIFRRLRRLKQPISLFGETPWKRYDRLCKLELQAIDDETTEGQKNVFHA 148 E+ RRLR +PI LFGET + + RL K+E+ + E +G +N A Sbjct 83 EVIRRLRERGEPIRLFGETDYDAFQRLRKIEI--LTPEVNKGLRNDLKA 129 > CE05372 Length=496 Score = 32.0 bits (71), Expect = 0.51, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 0/46 (0%) Query 92 LVPPVDLPEIFRRLRRLKQPISLFGETPWKRYDRLCKLELQAIDDE 137 L P D ++ +LR L QPI LFGE R +RL L +DE Sbjct 72 LTLPTDDVQVKLKLRALNQPICLFGEDALDRRERLRALLSTMSEDE 117 > 7300471 Length=340 Score = 32.0 bits (71), Expect = 0.57, Method: Compositional matrix adjust. Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Query 71 SSEAEATVADAGDTAEGREEELVPPVDLPEIFRRLRRLKQPISLFGETPWKRYDRLCKLE 130 S EA+ + + + ++P E+ RRLR +PI +FGET + +DRL + E Sbjct 52 SVEAQGQTTEGAYSFVADGQNILPRT---EVIRRLRERGEPILIFGETEPEAFDRLRQCE 108 Query 131 LQAIDDETTEGQKNVF 146 + E G +N F Sbjct 109 IS--QPEANRGFRNDF 122 > 7298625 Length=604 Score = 31.6 bits (70), Expect = 0.67, Method: Compositional matrix adjust. Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 12/99 (12%) Query 30 QKLREQKDREQEETANKKRKTELQQLAELQERLKARAFQPHSSEAEATVADAGDTAEGRE 89 +KL+EQ+++E+ N +T +Q +E E L A S+ AT D+A GR+ Sbjct 191 RKLKEQQEKEK----NPSEETGEKQPSETTEILDAEKQTDTKSKPTATGCAIDDSAIGRD 246 Query 90 EELVPPVDLPEIFRRLRRLKQPISLFGETPWKRYDRLCK 128 + P VD R + + P++ G P++ R+CK Sbjct 247 ADHKPAVDF-----REKLVLSPLTTLGNLPFR---RICK 277 > At2g41500 Length=554 Score = 31.6 bits (70), Expect = 0.75, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 0/42 (0%) Query 88 REEELVPPVDLPEIFRRLRRLKQPISLFGETPWKRYDRLCKL 129 R + P + + RLRRL +PI+LFGE +R RL +L Sbjct 113 RAAAMAVPTNDKAVRDRLRRLGEPITLFGEQEMERRARLTQL 154 > Hs4758558 Length=522 Score = 31.6 bits (70), Expect = 0.79, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 0/39 (0%) Query 88 REEELVPPVDLPEIFRRLRRLKQPISLFGETPWKRYDRL 126 R ++ D E+ LR L +PI+LFGE P +R +RL Sbjct 95 RARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERL 133 > SPCC126.14 Length=343 Score = 31.2 bits (69), Expect = 1.0, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 34/55 (61%), Gaps = 5/55 (9%) Query 96 VDLPEIFRRLRRLKQPISLFGET---PWKRYDRLCKL-ELQAIDDE-TTEGQKNV 145 + L EI +LR +K+PI LFGE+ +RY L K +L+ I++E T+G + + Sbjct 124 LTLTEIIAKLREMKEPIRLFGESEEATIQRYYSLLKYKKLEEIENELLTKGVETI 178 > 7298384 Length=499 Score = 28.1 bits (61), Expect = 8.5, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Query 31 KLREQKDREQEETANKKRKTELQQLAELQERLKARAFQPHSSEAE 75 ++R +K++ EE A K R +++ L E+Q++LK+ FQ H + + Sbjct 288 QIRNEKEKLAEEVATKDR--DIENLQEMQQQLKSELFQVHGQQGQ 330 > YMR294w Length=373 Score = 27.7 bits (60), Expect = 9.3, Method: Compositional matrix adjust. Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 5/75 (6%) Query 42 ETANKKRKTELQQLAELQERLKARAFQPHSSEAEATVADAGDTAEGREEELVPPVDL-PE 100 E + +TE+++L E+Q +L + SS +T EG++ ++P + L Sbjct 116 ENLTSEMQTEIKELCEIQSKLATES----SSRLTNLRKKLLETYEGQDTVILPNIILDTS 171 Query 101 IFRRLRRLKQPISLF 115 +RL++L Q ISL Sbjct 172 NIKRLQKLDQKISLM 186 > Hs14747970 Length=794 Score = 27.7 bits (60), Expect = 9.8, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 9/50 (18%) Query 8 KQQINELPKAGPGKYILQKDLQQKLREQKDREQEETANKKRKTELQQLAE 57 KQ +++ K G G Y L +L D+EQE+ A+ RK ELQ+L+ Sbjct 737 KQLVSQSKKTGQGDYPLNNEL--------DKEQEDVASTTRK-ELQELSS 777 Lambda K H 0.311 0.130 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2244926132 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40