bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2529_orf1 Length=78 Score E Sequences producing significant alignments: (Bits) Value At3g62310 48.5 3e-06 CE01334 47.4 7e-06 Hs20336300 44.7 4e-05 SPBC16H5.10c 42.4 2e-04 At2g47250 41.6 4e-04 YGL120c 40.0 0.001 Hs4557517 40.0 0.001 7304234 32.3 0.24 7292573 30.4 0.74 Hs9257195 30.4 0.85 > At3g62310 Length=726 Score = 48.5 bits (114), Expect = 3e-06, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 24/34 (70%), Gaps = 0/34 (0%) Query 42 INPFNGRPFSDRYYRILEGRKKLPAWGSQRHFLK 75 IN +NG+P+S RYY ILE R+ LP W + FLK Sbjct 39 INKWNGKPYSQRYYDILEKRRTLPVWLQKEEFLK 72 > CE01334 Length=739 Score = 47.4 bits (111), Expect = 7e-06, Method: Composition-based stats. Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 0/36 (0%) Query 42 INPFNGRPFSDRYYRILEGRKKLPAWGSQRHFLKLV 77 INP+N +PFS+RY+ I E R +LP W + F++L+ Sbjct 54 INPYNNQPFSNRYWAIWEKRSQLPVWEYKEKFMELL 89 > Hs20336300 Length=743 Score = 44.7 bits (104), Expect = 4e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 25/34 (73%), Gaps = 0/34 (0%) Query 42 INPFNGRPFSDRYYRILEGRKKLPAWGSQRHFLK 75 +NPF+G P+S RYY++L+ R+ LP W + F++ Sbjct 40 LNPFDGLPYSSRYYKLLKEREDLPIWKEKYSFME 73 > SPBC16H5.10c Length=735 Score = 42.4 bits (98), Expect = 2e-04, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 15/64 (23%) Query 13 AAAAAAAAAAVNGPIGPTGPTSGPEPADGINPFNGRPFSDRYYRILEGRKKLPAWGSQRH 72 A A AA A GP N FN +PFS Y++ILE R++LP + + Sbjct 39 ATTVAQAAKAEEGPN---------------NFFNDKPFSQNYFKILETRRELPVYQQREE 83 Query 73 FLKL 76 FLK+ Sbjct 84 FLKI 87 > At2g47250 Length=729 Score = 41.6 bits (96), Expect = 4e-04, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 42 INPFNGRPFSDRYYRILEGRKKLPAWGSQRHFL 74 IN +NG+ +S RY+ ILE R+ LP W + FL Sbjct 43 INKWNGKAYSQRYFEILEKRRDLPVWLQKDDFL 75 > YGL120c Length=767 Score = 40.0 bits (92), Expect = 0.001, Method: Composition-based stats. Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Query 40 DG-INPFNGRPFSDRYYRILEGRKKLPAWGSQRHFLKL 76 DG INPF GR F+ +Y IL+ R++LP + FLKL Sbjct 68 DGKINPFTGREFTPKYVDILKIRRELPVHAQRDEFLKL 105 > Hs4557517 Length=813 Score = 40.0 bits (92), Expect = 0.001, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Query 28 GPTGPTSGPEPADGINPFNGRPFSDRYYRILEGRKKLPAWGSQRHFLKLVA 78 G G TS P+ INPF P + RYY IL+ R +LP W + F ++ Sbjct 104 GHAGHTSLPQ---CINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILG 151 > 7304234 Length=729 Score = 32.3 bits (72), Expect = 0.24, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 42 INPFNGRPFSDRYYRILEGRKKLPAWGSQRHFLKLVA 78 +NP P+S RY + + R LP + Q F++L++ Sbjct 50 MNPLTNTPYSQRYQNLYKKRIALPVFEYQADFMRLLS 86 > 7292573 Length=1280 Score = 30.4 bits (67), Expect = 0.74, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 42 INPFNGRPFSDRYYRILEGRKKLPAWGSQRHFLKLV 77 + F R +RY +I++GRK+LPA+ L L+ Sbjct 423 LQQFVERRKEERYQKIIDGRKQLPAFAEIERILALI 458 > Hs9257195 Length=1256 Score = 30.4 bits (67), Expect = 0.85, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 21 AAVNGPIGPTGPTSGPEPADGINPFNGRPFSDRYYRILEGR 61 +A+ P+ P P S PEPA + P G+PF R L+G+ Sbjct 430 SALVPPVIPNHPPSNPEPAREV-PLQGKPFFTRNPSELKGK 469 Lambda K H 0.316 0.135 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171925608 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40