bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2480_orf1 Length=88 Score E Sequences producing significant alignments: (Bits) Value At3g50670 65.1 3e-11 CE01998 48.5 3e-06 7297205 42.4 2e-04 SPAC19A8.13 40.8 6e-04 Hs22050771 39.7 0.001 Hs4507119 39.7 0.001 Hs22055158 35.4 0.029 At2g43370 33.5 0.088 7293353 31.2 0.49 At4g36690 30.4 0.89 Hs16193855 30.0 0.96 At5g16780 28.9 2.3 Hs5902144 28.1 4.0 7299212 27.3 6.4 7295594 26.9 8.5 > At3g50670 Length=427 Score = 65.1 bits (157), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 44/94 (46%), Positives = 56/94 (59%), Gaps = 12/94 (12%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPRG------AGKNQPDISSLVAQISAPPP 54 KIDGRRVLVDVER RTVP W PRRLGGG G R G+ QP +Q P Sbjct 203 KIDGRRVLVDVERGRTVPNWRPRRLGGGLGTSRVGGGEEIVGEQQP--QGRTSQSEEPSR 260 Query 55 SSDSKDKTRDRDRDRERDR----ERDRDRERDTP 84 + ++K+R++ ++RER R E+ R+R RD P Sbjct 261 PREEREKSREKGKERERSRELSHEQPRERSRDRP 294 > CE01998 Length=328 Score = 48.5 bits (114), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 21/33 (63%), Positives = 26/33 (78%), Gaps = 0/33 (0%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPR 33 K+DG+R++VD ER RT WLPRRLGGG+G R Sbjct 164 KVDGKRLVVDYERGRTQKTWLPRRLGGGKGDTR 196 > 7297205 Length=448 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/23 (86%), Positives = 21/23 (91%), Gaps = 0/23 (0%) Query 1 KIDGRRVLVDVERARTVPGWLPR 23 KID +RVLVDVERARTV GWLPR Sbjct 167 KIDSKRVLVDVERARTVKGWLPR 189 > SPAC19A8.13 Length=261 Score = 40.8 bits (94), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 16/23 (69%), Positives = 21/23 (91%), Gaps = 0/23 (0%) Query 2 IDGRRVLVDVERARTVPGWLPRR 24 ++GRR++VDVER RTV GWLPR+ Sbjct 166 LNGRRIVVDVERGRTVKGWLPRK 188 > Hs22050771 Length=437 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%) Query 1 KIDGRRVLVDVERARTVPGW 20 KIDGRRVLVDVER RTV GW Sbjct 168 KIDGRRVLVDVERGRTVKGW 187 > Hs4507119 Length=614 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%) Query 1 KIDGRRVLVDVERARTVPGW 20 KIDGRRVLVDVER RTV GW Sbjct 345 KIDGRRVLVDVERGRTVKGW 364 > Hs22055158 Length=1514 Score = 35.4 bits (80), Expect = 0.029, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Query 52 PPPSSDSKDKTRDR---DRDRERDRERDRDRERDTPSQR 87 PPP S SK++ D+ D+ RER RER++ E+D ++ Sbjct 1365 PPPLSKSKEREMDKKDLDKSRERSREREKKDEKDRKERK 1403 > At2g43370 Length=292 Score = 33.5 bits (75), Expect = 0.088, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 2 IDGRRVLVDVERARTVPGWLPR 23 IDGR ++VD R + +PGW+PR Sbjct 124 IDGREIIVDYNRQQLMPGWIPR 145 > 7293353 Length=1783 Score = 31.2 bits (69), Expect = 0.49, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 57 DSKDKTRDRDRDRERDRERDRDRERD 82 D+K R+RDR+ ERDR+R+RD+ D Sbjct 183 DTKSPCRERDRNLERDRDRERDKNDD 208 > At4g36690 Length=573 Score = 30.4 bits (67), Expect = 0.89, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Query 54 PSSDSKDKTRD--RDRDRERDRERDRDRERDTPSQR 87 P +S+D R+ R +DRER++ RD+DRERD+ R Sbjct 37 PKRESRDHERETSRSKDREREKGRDKDRERDSEVSR 72 Score = 28.1 bits (61), Expect = 4.2, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 57 DSKDKTRDRDRDRERDRERDRDRERD 82 DS+ R RDRD E+ +ER RD++RD Sbjct 67 DSEVSRRSRDRDGEKSKERSRDKDRD 92 > Hs16193855 Length=478 Score = 30.0 bits (66), Expect = 0.96, Method: Compositional matrix adjust. Identities = 15/24 (62%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 59 KDKTRDRDRDRERDRERDRDRERD 82 KD +RD DR+RER RDR+RE D Sbjct 379 KDSSRDWDRNRERSANRDREREAD 402 > At5g16780 Length=820 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 24/30 (80%), Gaps = 0/30 (0%) Query 58 SKDKTRDRDRDRERDRERDRDRERDTPSQR 87 S+D+ +++D+++ER+R +DR+ ERD ++ Sbjct 91 SRDRVKEKDKEKERNRHKDRENERDNEKEK 120 > Hs5902144 Length=246 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Query 2 IDGRRVLVDVERARTVPGWLPRRLGGGR------GQPRGAGKNQP 40 ID + VD E RT+ GW+PRRLGGG GQ R G+++P Sbjct 117 IDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRP 161 > 7299212 Length=874 Score = 27.3 bits (59), Expect = 6.4, Method: Compositional matrix adjust. Identities = 11/19 (57%), Positives = 17/19 (89%), Gaps = 0/19 (0%) Query 59 KDKTRDRDRDRERDRERDR 77 KDK +DRDRD+ ++++RDR Sbjct 178 KDKEKDRDRDKSKEKDRDR 196 Score = 27.3 bits (59), Expect = 7.6, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 57 DSKDKTRDRDRDRERDRERDRDRERD 82 D + K +++DRDR++ +E+DRDR D Sbjct 174 DIRVKDKEKDRDRDKSKEKDRDRVTD 199 > 7295594 Length=720 Score = 26.9 bits (58), Expect = 8.5, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 57 DSKDKTRDRDRDRERDRERDRDRER 81 D +DK RD+ R+RE+D+ RD+ RE Sbjct 47 DHRDKERDQRREREKDKSRDKKREH 71 Lambda K H 0.313 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184307974 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40