bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2461_orf1 Length=104 Score E Sequences producing significant alignments: (Bits) Value 7298005 30.8 0.56 At2g41290 29.3 1.7 Hs4504949 28.9 2.1 Hs17459774 28.9 2.3 Hs20558378 28.9 2.5 At5g56740 28.5 2.8 CE27956 28.5 3.0 Hs22041980 28.5 3.1 Hs11560152 28.1 4.2 At1g79780 28.1 4.5 7298206 27.7 4.9 Hs14786624 26.9 8.1 > 7298005 Length=747 Score = 30.8 bits (68), Expect = 0.56, Method: Compositional matrix adjust. Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 4/72 (5%) Query 32 IQTRFLYERLSENKINSYLYPLSSRIPVEKHGFPPPMLATHHLRSHSPGEPNICSSVQGQ 91 I FL ++L + K N++++PLS V PP LA ++ + P + N C++ Sbjct 48 IGQDFLEQQLEQYKANNFMFPLSMAGFVSADSAPPGDLAKENMENSLP-DGNPCNNNNDD 106 Query 92 EF---KKRSNHA 100 E K R N++ Sbjct 107 ELPQCKIRRNYS 118 > At2g41290 Length=376 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 11/22 (50%), Gaps = 0/22 (0%) Query 8 CFEPHHHTHSHEVCSRPLNAGF 29 C PH H + VC RPL F Sbjct 96 CEGPHEHQRTEHVCGRPLGLAF 117 > Hs4504949 Length=1816 Score = 28.9 bits (63), Expect = 2.1, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 63 GFPPPMLATHHLRSHSPGEPNICSSVQGQEFKKRS 97 G PP +L + LR+H P + N ++G +F+K+ Sbjct 1170 GAPPEILQSRALRAHLPLDINFRGCMKGFQFQKKD 1204 > Hs17459774 Length=211 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 53 LSSRIPVEKHGFPPPMLATHHLRSHSPGEPNICSSVQG 90 L+S++P+E G + HL S S G C+SVQG Sbjct 118 LASQMPMETTGSQVAVANQPHLNSRSKGGHTYCNSVQG 155 > Hs20558378 Length=1938 Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Query 17 SHEVCSRPLNAGFRSIQTRFLYERLSENKINSYLYP-LSSRIPVEKHGFPPPMLATHHLR 75 S E+ RPL+ +Q + +RL+ ++IN +LY S R+P H + A H Sbjct 1508 SQELEERPLSRQVFIVQELEVRDRLASSQINKFLYLHTSERMPRRAHSNMLTIKALHVAP 1567 Query 76 SHSPGEPNICSSV 88 + + G P C V Sbjct 1568 TTNLGGPECCLRV 1580 > At5g56740 Length=467 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 0/66 (0%) Query 36 FLYERLSENKINSYLYPLSSRIPVEKHGFPPPMLATHHLRSHSPGEPNICSSVQGQEFKK 95 +L E ++ I +Y L+ P EK + + LRS P +P+I S+VQ K Sbjct 263 YLMEVVNNVAITENVYDLTVEEPSEKFQHIRTCIDINRLRSFDPIKPDIDSAVQTLTKGK 322 Query 96 RSNHAE 101 S A+ Sbjct 323 LSKKAQ 328 > CE27956 Length=982 Score = 28.5 bits (62), Expect = 3.0, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 73 HLRSHSPGEPNICSSVQGQEFKKRS 97 H+R H+PG P +CS Q Q F + S Sbjct 947 HMRFHTPGNPFMCSDCQYQAFNELS 971 > Hs22041980 Length=568 Score = 28.5 bits (62), Expect = 3.1, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 0/48 (0%) Query 14 HTHSHEVCSRPLNAGFRSIQTRFLYERLSENKINSYLYPLSSRIPVEK 61 H H +V RPL RS+ + + +E K + Y L S PVEK Sbjct 278 HDHRTDVDYRPLPVAQRSLSPQAEGQAQAEGKASEGTYALDSESPVEK 325 > Hs11560152 Length=1342 Score = 28.1 bits (61), Expect = 4.2, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 9/53 (16%) Query 45 KINSYLYPLSSRI-PVEKHGFPPPMLATHHLRSHSPGEPNICSSVQGQEFKKR 96 K++S+ P+ R+ P++K T H+++HS +P++C G+ FKKR Sbjct 558 KLSSFPCPVCGRVYPMQKR-------LTQHMKTHSTEKPHMCDKC-GKSFKKR 602 > At1g79780 Length=168 Score = 28.1 bits (61), Expect = 4.5, Method: Compositional matrix adjust. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 0/32 (0%) Query 53 LSSRIPVEKHGFPPPMLATHHLRSHSPGEPNI 84 L +R + H FP P LA HLRS G N+ Sbjct 85 LQTRHRISHHAFPLPSLALLHLRSAGSGVTNL 116 > 7298206 Length=593 Score = 27.7 bits (60), Expect = 4.9, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query 68 MLATHHLRSHSPGEPNICSSVQGQEFKKRSN 98 ML H+R+HS +P C SV G+ F RSN Sbjct 430 MLLKQHMRTHSGEKPYQC-SVCGKSFADRSN 459 > Hs14786624 Length=782 Score = 26.9 bits (58), Expect = 8.1, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 8/64 (12%) Query 22 SRPLNAGFRSIQTRFLYERLSENKI---NSYLYPLSSRI--PVEKHGF---PPPMLATHH 73 S P GFR T+FLY + + S + P +SRI P + + PP + Sbjct 559 SLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQ 618 Query 74 LRSH 77 +RSH Sbjct 619 IRSH 622 Lambda K H 0.317 0.131 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1174332180 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40