bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2444_orf1 Length=71 Score E Sequences producing significant alignments: (Bits) Value 7292130 40.0 0.001 Hs22049504 37.0 0.008 CE25503 33.5 0.098 CE06626 28.9 2.3 Hs13994343 28.1 4.0 At3g10550 26.9 9.9 > 7292130 Length=1430 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 0/46 (0%) Query 25 DRGRMRAIELKVTELQVQLEDQSISKEEIASRCDALRQKLLEEHKT 70 D R R IE+K EL+ LE Q + EEI S+ D+ RQKL+ + KT Sbjct 58 DHDRKRKIEVKCLELEDILEKQGRTPEEIKSQVDSFRQKLMGQGKT 103 > Hs22049504 Length=154 Score = 37.0 bits (84), Expect = 0.008, Method: Compositional matrix adjust. Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 0/42 (0%) Query 25 DRGRMRAIELKVTELQVQLEDQSISKEEIASRCDALRQKLLE 66 D R R +ELK ELQ +E+Q S+EEI + RQ L+E Sbjct 56 DHERKRRVELKCMELQEMMEEQGYSEEEIRQKVGTFRQMLME 97 > CE25503 Length=425 Score = 33.5 bits (75), Expect = 0.098, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 0/43 (0%) Query 25 DRGRMRAIELKVTELQVQLEDQSISKEEIASRCDALRQKLLEE 67 D R R IE+K TE ++ LED+ + E+I + R+ LL++ Sbjct 58 DHNRKRQIEVKCTEFEMLLEDKGLDDEDIERKVGEYRKNLLKQ 100 > CE06626 Length=1278 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 34/54 (62%), Gaps = 2/54 (3%) Query 18 SQEARESDRGRMRAIELKVTELQVQLEDQSISKEEIASRCDALRQKLLEEHKTT 71 S E R S+ R R I+ K+TEL+ Q+ D+ I+KE++ + D + LL +H+ T Sbjct 301 SFELRSSEEVRSRLIQ-KITELEKQIGDERIAKEQLQAWQDE-NKVLLSDHQDT 352 > Hs13994343 Length=592 Score = 28.1 bits (61), Expect = 4.0, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 7/69 (10%) Query 4 NEGAAASEATAAAESQEARESDRGRMRAIE------LKVTELQVQLEDQSISKEEIASRC 57 NEG AS AT + +A +SDRG + A + L T ++ ED S+ ++ ++ R Sbjct 422 NEGGEASNATHGNSNIDAAKSDRGGLDAPDCLPYDSLSFTS-RMYNEDDSVVEKAVSVRP 480 Query 58 DALRQKLLE 66 +A LE Sbjct 481 EAAPASQLE 489 > At3g10550 Length=609 Score = 26.9 bits (58), Expect = 9.9, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Query 19 QEARESDRG-RMRAIELKVTELQVQLEDQSISKEEIASRCDALRQKLLEE 67 +EA+ +D G + RA+ +K +E+Q + E +EI+ ++L +LL E Sbjct 426 EEAKAADIGVQCRAMTVKYSEMQKEKEAAERRVDEISFAMESLSAELLRE 475 Lambda K H 0.301 0.115 0.278 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194057928 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40