bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2239_orf2 Length=56 Score E Sequences producing significant alignments: (Bits) Value SPAC6G10.02c_1 33.5 0.095 YAL056w 33.5 0.11 Hs14744278 32.0 0.30 7290098 31.6 0.34 At4g03080_1 31.6 0.36 SPCC1223.06 31.6 0.38 At1g51550 31.2 0.50 Hs7019405 30.4 0.90 7301756 29.3 1.8 YOR371c 28.9 2.6 7295586 28.5 3.4 At1g03445_1 28.1 3.9 At1g74150 28.1 4.5 Hs5032015 28.1 4.6 YGR238c 28.1 4.6 At5g01660_2 27.7 5.2 At3g05420_2 27.7 6.0 At4g04670_2 27.3 7.7 > SPAC6G10.02c_1 Length=343 Score = 33.5 bits (75), Expect = 0.095, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Query 2 RSCHA-SVVFEKVFVHGGMSGDTVLDDMWMWDGE--EWSQVR 40 RS H+ ++V K+FVHGG + L D+W++D E W++VR Sbjct 248 RSNHSVTLVQGKIFVHGGHNDTGPLSDLWLFDLETLSWTEVR 289 > YAL056w Length=847 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query 9 VFEKVFVHGGMSGDTVLDDMWMWD--GEEWSQV 39 V + V +HGG +G VLDDMW+ D E W+ + Sbjct 688 VGKTVVLHGGSNGLNVLDDMWLMDLECETWTPI 720 > Hs14744278 Length=299 Score = 32.0 bits (71), Expect = 0.30, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query 2 RSCHASV-VFEKVFVHGGMSGDTVLDDMWMWDGEEWSQVRYDKST-EPMLARCG 53 R CH+ V + VF+ GG +G+ +L D+W + + + V+ + EP+ C Sbjct 173 RRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQTFQWVKLPATMPEPVYFHCA 226 > 7290098 Length=975 Score = 31.6 bits (70), Expect = 0.34, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Query 2 RSCHASVVFE-KVFVHGGMSGDTVLDDMWMWD--GE-EWSQV 39 RS H + V++ K++++ G G+ L+DMW + GE +W +V Sbjct 359 RSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNLTGENQWEEV 400 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query 1 KRSCHASVVF-EKVFVHGGMSGDTVLDDMWMWDGEEWSQVRYDKSTEPMLARCGHSA 56 KRS H V + + +FV GG +G +L+D+ + ++ S R + P R HSA Sbjct 251 KRSKHTVVAYKDAMFVFGGDNGKNMLNDLIRFGVKDKSWGRACATGTPPAPRYHHSA 307 > At4g03080_1 Length=533 Score = 31.6 bits (70), Expect = 0.36, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Query 2 RSCH--ASVVFEKVFVHGGMSGDTVLDDMWMWDGEEWSQVRYDKSTEPMLA 50 R C A+ V +++VHGG+ GD +LDD + E S + D S+ P+LA Sbjct 330 RRCRHGAASVGIRIYVHGGLRGDVLLDDFLV---AENSTFQSDISS-PLLA 376 > SPCC1223.06 Length=1147 Score = 31.6 bits (70), Expect = 0.38, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 7/59 (11%) Query 2 RSCHASVVF-EKVFVHGGMSGDTVLDDMWMWDGEE--WSQVR-YDKSTEPMLARCGHSA 56 R+ H + F +K+++ GG G +D+W + ++ WS+V + + P R GH+A Sbjct 243 RAGHVAFTFSDKLYIFGGTDGANFFNDLWCYHPKQSAWSKVETFGVAPNP---RAGHAA 298 > At1g51550 Length=478 Score = 31.2 bits (69), Expect = 0.50, Method: Compositional matrix adjust. Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 9/55 (16%) Query 11 EKVFVHGGMS-GDTVLDDMWMWDGEE-----WSQVRYDKSTEP---MLARCGHSA 56 +V + GG G VLDD+W+ D +E W Q+ YD P L R GHSA Sbjct 300 NQVVLFGGRGLGYDVLDDVWILDIQEPCEEKWIQIFYDFQDVPEYASLPRVGHSA 354 > Hs7019405 Length=792 Score = 30.4 bits (67), Expect = 0.90, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 12/64 (18%) Query 2 RSCHASVVF-------EKVFVHGGMSGDTVLDDMWMWDGE--EWSQVRYDKSTEPMLARC 52 R H +V++ K++V GGM G LDD+W D E WS+ K T P L R Sbjct 190 RESHTAVIYCKKDSGSPKMYVFGGMCG-ARLDDLWQLDLETMSWSKPE-TKGTVP-LPRS 246 Query 53 GHSA 56 H+A Sbjct 247 LHTA 250 > 7301756 Length=1020 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Query 4 CHASVVFEKVFVHGGMSGDTVLDDM--WMWDGEEWSQV 39 CH + V F+H G + D L D W+ W+++ Sbjct 380 CHTATVIANAFMHSGTTSDQFLRDNLDWLARATNWAKL 417 > YOR371c Length=897 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 10/50 (20%) Query 16 HGGMSGDTVLDDMWM--WDGEEWSQVR-YDKSTE------PM-LARCGHS 55 HGG G V DMW +D E W+++ Y K+ E P+ L GHS Sbjct 719 HGGSDGYDVCSDMWWFDFDSETWTKIDLYAKTQEESDGLVPINLCMVGHS 768 > 7295586 Length=616 Score = 28.5 bits (62), Expect = 3.4, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Query 2 RSCHASVVF-EKVFVHGGMSGDTVLDDMWMWD--GEEWSQV 39 RS HA VV +K+++ GG+ +L MW++D E W ++ Sbjct 448 RSQHAGVVVGDKLYISGGVHLANILASMWVFDTKTEVWQEL 488 > At1g03445_1 Length=472 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query 1 KRSCHASVVF-EKVFVHGGMSGDTVLDDM 28 +R HA+ F ++VHGG+ D +LDD+ Sbjct 321 RRCHHAAASFGSHLYVHGGIREDVLLDDL 349 > At1g74150 Length=552 Score = 28.1 bits (61), Expect = 4.5, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query 2 RSCHA-SVVFEKVFVHGGMSGDTVLDDMWMWDGEEWSQVRYDKSTEPMLARCGHSA 56 R H+ + V + +FV GG G L+D+ + D + +R D E R HSA Sbjct 75 RDSHSCTTVGDNLFVFGGTDGTKYLNDVHILDTYSHTWIRPDIRGEGPRVREAHSA 130 > Hs5032015 Length=372 Score = 28.1 bits (61), Expect = 4.6, Method: Compositional matrix adjust. Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 12 KVFVHGGMSGDTVLDDMWMWD 32 K+F+HGG++GD DD+ D Sbjct 204 KLFIHGGLAGDRFYDDLHCID 224 > YGR238c Length=882 Score = 28.1 bits (61), Expect = 4.6, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Query 12 KVFVHGGMSGDTVLDDMWM----WDGEEWSQVRYDKSTEPMLARCGHSA 56 ++FV GG+ +V D+W DG ++ R D R GH++ Sbjct 99 RIFVTGGLHDQSVYGDVWQIAANADGTSFTSKRIDIDQNTPPPRVGHAS 147 > At5g01660_2 Length=301 Score = 27.7 bits (60), Expect = 5.2, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Query 1 KRSCHASVVF-EKVFVHGGMSGDTVLDDMWMWDGEEWSQVRYDKSTEPMLARCGHSA 56 +R CH+ VV EK++ GG G+T++ + +++ + + + EPM G+SA Sbjct 196 RRGCHSLVVLNEKLYAIGGFDGETMVSSVEIYEPRTGTWM----TGEPMKDLRGYSA 248 > At3g05420_2 Length=429 Score = 27.7 bits (60), Expect = 6.0, Method: Compositional matrix adjust. Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 10/60 (16%) Query 6 ASVVFEKVFVHGGMSGDTVLDDMWMWDGEEWSQVRY---------DKSTEPMLARC-GHS 55 A+V+ +K++++GG L D+ + D + W+ R + ST +LA C GHS Sbjct 86 AAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVATESQETSTPTLLAPCAGHS 145 > At4g04670_2 Length=506 Score = 27.3 bits (59), Expect = 7.7, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query 2 RSCHASVVF-EKVFVHGGMSGDTVLDDMWMWDGEEWS 37 R HA V + + F+ GG +G+ VL+D++ +D + S Sbjct 226 RHSHAMVAYGSQSFMFGGYNGENVLNDLYSFDVQSCS 262 Lambda K H 0.320 0.132 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194096762 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40