bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2238_orf1 Length=56 Score E Sequences producing significant alignments: (Bits) Value CE09274 38.1 0.004 Hs5174647 37.7 0.006 CE28099 37.0 0.010 CE23343 36.6 0.012 CE23332 36.6 0.012 CE09248 36.6 0.012 At2g40730 36.6 0.013 CE19860 36.2 0.014 CE03838 36.2 0.016 CE29341 36.2 0.017 CE28667 36.2 0.017 Hs4505683 35.8 0.018 CE12472 35.8 0.021 CE28819 35.8 0.022 CE27551 35.4 0.027 CE19585_1 35.0 0.032 7299480 35.0 0.036 CE02991 35.0 0.036 Hs4503787 34.7 0.040 Hs15718680 34.7 0.041 7292519 34.7 0.044 Hs4505055 34.7 0.045 CE03440 34.7 0.048 Hs4885235 34.7 0.050 CE03437 34.7 0.050 CE09296 34.3 0.051 CE27218 34.3 0.051 CE05549 34.3 0.056 7304167 34.3 0.057 CE28068 34.3 0.059 Hs13186236 34.3 0.063 Hs13186234 34.3 0.063 Hs13112048 33.9 0.067 CE19114 33.9 0.067 Hs4503711 33.9 0.069 Hs13186249 33.9 0.069 Hs13186251 33.9 0.070 Hs11276087 33.9 0.070 Hs4557695 33.9 0.073 Hs13112052 33.9 0.075 Hs4503823 33.9 0.079 Hs13112050 33.9 0.079 Hs8923539 33.9 0.085 Hs18250298 33.5 0.087 Hs21450846 33.5 0.089 Hs21450844 33.5 0.090 Hs21450842 33.5 0.091 Hs4885609 33.5 0.092 Hs13186263 33.5 0.095 Hs4758078 33.5 0.098 > CE09274 Length=894 Score = 38.1 bits (87), Expect = 0.004, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Query 25 SDLWSLGMLLYELFTGGNVPY-TEDERDYLEY 55 +D+WS G+LL+E+F+ G+VPY T + D LE+ Sbjct 709 TDVWSFGVLLFEIFSMGDVPYPTIQQVDMLEH 740 > Hs5174647 Length=451 Score = 37.7 bits (86), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 16/52 (30%) Query 10 IQEDVY------------AENAVPQAH----SDLWSLGMLLYELFTGGNVPY 45 I+EDVY A A+ + H SD+WS G+LL+E+F+ G VPY Sbjct 337 IKEDVYLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPY 388 > CE28099 Length=387 Score = 37.0 bits (84), Expect = 0.010, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 23 AHSDLWSLGMLLYELFTGGNVPYTEDERDYLEY 55 + SD+WS G+ L+ELF+ G PY E E + + Y Sbjct 272 SKSDVWSFGVCLFELFSLGEPPYKELESNNIAY 304 > CE23343 Length=521 Score = 36.6 bits (83), Expect = 0.012, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 7/54 (12%) Query 2 RYVEPTLRIQEDVYAENAVPQAHSDLWSLGMLLYELFTGGNVPYTE-DERDYLE 54 R++ P L D +++ SD+WSLG+L YE+FT P+ D+ D ++ Sbjct 364 RWMSPELVDTPDAFSK------MSDMWSLGILAYEIFTNATKPFFNLDDTDVMQ 411 > CE23332 Length=521 Score = 36.6 bits (83), Expect = 0.012, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 7/54 (12%) Query 2 RYVEPTLRIQEDVYAENAVPQAHSDLWSLGMLLYELFTGGNVPYTE-DERDYLE 54 R++ P L D +++ SD+WSLG+L YE+FT P+ D+ D ++ Sbjct 364 RWMSPELVDTPDAFSK------MSDMWSLGILAYEIFTNATKPFFNLDDTDVMQ 411 > CE09248 Length=478 Score = 36.6 bits (83), Expect = 0.012, Method: Composition-based stats. Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 25 SDLWSLGMLLYELFTGGNVPYTE 47 SD+WS G+LL+ELF+ G VPY E Sbjct 372 SDVWSYGVLLWELFSLGEVPYGE 394 > At2g40730 Length=604 Score = 36.6 bits (83), Expect = 0.013, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 0/51 (0%) Query 1 GRYVEPTLRIQEDVYAENAVPQAHSDLWSLGMLLYELFTGGNVPYTEDERD 51 G +P ++ D A P D W LG L+YELF+G + TE+ R+ Sbjct 198 GTQYKPMEMVKSDWVAIRKSPPWAIDSWGLGCLIYELFSGSKLAKTEELRN 248 > CE19860 Length=202 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 17 ENAVPQAHSDLWSLGMLLYELFTGGNVPY 45 E+ + + SD+WS G+ LYE+FT G PY Sbjct 110 EHQMFSSKSDVWSFGICLYEIFTLGGTPY 138 > CE03838 Length=498 Score = 36.2 bits (82), Expect = 0.016, Method: Composition-based stats. Identities = 19/36 (52%), Positives = 23/36 (63%), Gaps = 5/36 (13%) Query 25 SDLWSLGMLLYELFTGGNVPYTE----DERD-YLEY 55 SD+WS G+ LYELF+ G PY DERD Y +Y Sbjct 376 SDVWSYGVCLYELFSLGKSPYKNVIKYDERDSYCKY 411 > CE29341 Length=1030 Score = 36.2 bits (82), Expect = 0.017, Method: Composition-based stats. Identities = 12/22 (54%), Positives = 19/22 (86%), Gaps = 0/22 (0%) Query 25 SDLWSLGMLLYELFTGGNVPYT 46 SD+WS G++++ELFT G+ PY+ Sbjct 916 SDIWSFGVVIWELFTRGSTPYS 937 > CE28667 Length=1086 Score = 36.2 bits (82), Expect = 0.017, Method: Composition-based stats. Identities = 12/22 (54%), Positives = 19/22 (86%), Gaps = 0/22 (0%) Query 25 SDLWSLGMLLYELFTGGNVPYT 46 SD+WS G++++ELFT G+ PY+ Sbjct 916 SDIWSFGVVIWELFTRGSTPYS 937 > Hs4505683 Length=1106 Score = 35.8 bits (81), Expect = 0.018, Method: Compositional matrix adjust. Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 0/23 (0%) Query 25 SDLWSLGMLLYELFTGGNVPYTE 47 SD+WS G+LL+E+FT G PY E Sbjct 884 SDVWSFGILLWEIFTLGGTPYPE 906 > CE12472 Length=495 Score = 35.8 bits (81), Expect = 0.021, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Query 25 SDLWSLGMLLYELFTGGNVPYTE--DERDYLEY 55 SD+WS G+ LYE+FT G +PY + ER Y EY Sbjct 381 SDVWSFGICLYEIFTLGQLPYPDVPSERIY-EY 412 > CE28819 Length=2364 Score = 35.8 bits (81), Expect = 0.022, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 21/27 (77%), Gaps = 0/27 (0%) Query 23 AHSDLWSLGMLLYELFTGGNVPYTEDE 49 + SD+W+ G+LLYE+F+ G VPY + + Sbjct 2039 SKSDVWAYGVLLYEVFSFGEVPYGDKD 2065 > CE27551 Length=558 Score = 35.4 bits (80), Expect = 0.027, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LLYE+ T G VPY Sbjct 462 SDVWSYGILLYEIMTKGQVPY 482 > CE19585_1 Length=463 Score = 35.0 bits (79), Expect = 0.032, Method: Composition-based stats. Identities = 13/21 (61%), Positives = 16/21 (76%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G+ LYE+FT G PY Sbjct 333 SDVWSFGLCLYEIFTLGGTPY 353 > 7299480 Length=820 Score = 35.0 bits (79), Expect = 0.036, Method: Composition-based stats. Identities = 12/21 (57%), Positives = 18/21 (85%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+++ G VPY Sbjct 724 SDMWSFGILLWEIYSFGRVPY 744 > CE02991 Length=502 Score = 35.0 bits (79), Expect = 0.036, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 4/32 (12%) Query 25 SDLWSLGMLLYELFTGGNVPYTE----DERDY 52 SD+WS G+ LYELF+ G PY D+RD+ Sbjct 380 SDVWSYGVCLYELFSLGKSPYENVIKYDQRDF 411 > Hs4503787 Length=505 Score = 34.7 bits (78), Expect = 0.040, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 18/22 (81%), Gaps = 0/22 (0%) Query 25 SDLWSLGMLLYELFTGGNVPYT 46 SD+WS G+LLYE+ T G +PY+ Sbjct 414 SDVWSFGILLYEIITYGKMPYS 435 > Hs15718680 Length=620 Score = 34.7 bits (78), Expect = 0.041, Method: Compositional matrix adjust. Identities = 11/23 (47%), Positives = 19/23 (82%), Gaps = 0/23 (0%) Query 23 AHSDLWSLGMLLYELFTGGNVPY 45 + SD+WS G+L++E+F+ G +PY Sbjct 537 SKSDVWSFGVLMWEVFSEGKIPY 559 > 7292519 Length=552 Score = 34.7 bits (78), Expect = 0.044, Method: Compositional matrix adjust. Identities = 15/21 (71%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL ELFT G VPY Sbjct 461 SDVWSYGILLMELFTYGQVPY 481 > Hs4505055 Length=512 Score = 34.7 bits (78), Expect = 0.045, Method: Composition-based stats. Identities = 13/21 (61%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LLYE+ T G +PY Sbjct 424 SDVWSFGILLYEIVTYGKIPY 444 > CE03440 Length=1199 Score = 34.7 bits (78), Expect = 0.048, Method: Composition-based stats. Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 25 SDLWSLGMLLYELFTGGNVPYTE 47 SD+WS G+ LYE+FT G PY + Sbjct 1085 SDVWSYGICLYEIFTLGGTPYPD 1107 > Hs4885235 Length=529 Score = 34.7 bits (78), Expect = 0.050, Method: Compositional matrix adjust. Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query 24 HSDLWSLGMLLYELFTGGNVPYTE-DERDYLE 54 SD+WS G+LL EL T G +PY ++R+ LE Sbjct 438 KSDVWSFGILLTELITKGRIPYPGMNKREVLE 469 > CE03437 Length=1227 Score = 34.7 bits (78), Expect = 0.050, Method: Composition-based stats. Identities = 13/21 (61%), Positives = 16/21 (76%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G+ LYE+FT G PY Sbjct 1090 SDVWSFGICLYEIFTLGGTPY 1110 > CE09296 Length=929 Score = 34.3 bits (77), Expect = 0.051, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 21/25 (84%), Gaps = 0/25 (0%) Query 25 SDLWSLGMLLYELFTGGNVPYTEDE 49 SD+WS G++++E+++ G+VP+ E E Sbjct 698 SDVWSFGIVIFEMYSLGDVPFAEIE 722 > CE27218 Length=397 Score = 34.3 bits (77), Expect = 0.051, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 23 AHSDLWSLGMLLYELFTGGNVPYTE 47 + SD+WS G+ LYE+F+ G PY E Sbjct 298 SKSDVWSYGVCLYEIFSLGESPYNE 322 > CE05549 Length=903 Score = 34.3 bits (77), Expect = 0.056, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 26 DLWSLGMLLYELFTGGNVPYTEDERDYL 53 D+WS+G +LYEL+TG + T + R++L Sbjct 764 DVWSIGCILYELYTGVTLFQTHENREHL 791 > 7304167 Length=923 Score = 34.3 bits (77), Expect = 0.057, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 20 VPQAHSDLWSLGMLLYELFTGGNVPY 45 V + SD+WS G+LLYE+ T G +PY Sbjct 795 VYTSQSDVWSFGVLLYEITTLGGMPY 820 > CE28068 Length=473 Score = 34.3 bits (77), Expect = 0.059, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 25 SDLWSLGMLLYELFTGGNVPYTEDERDYLE 54 +D+WS G+ L+ELF+ G PY E+ +++ + Sbjct 381 TDVWSYGVCLFELFSLGASPYLEEFQNFFD 410 > Hs13186236 Length=731 Score = 34.3 bits (77), Expect = 0.063, Method: Composition-based stats. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 589 QSDVWSFGVLLWEIFTLGGSPY 610 > Hs13186234 Length=733 Score = 34.3 bits (77), Expect = 0.063, Method: Composition-based stats. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 591 QSDVWSFGVLLWEIFTLGGSPY 612 > Hs13112048 Length=694 Score = 33.9 bits (76), Expect = 0.067, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 562 QSDVWSFGVLLWEIFTLGGSPY 583 > CE19114 Length=697 Score = 33.9 bits (76), Expect = 0.067, Method: Composition-based stats. Identities = 12/21 (57%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G++L+E+FT G PY Sbjct 559 SDVWSFGVVLWEIFTMGGCPY 579 > Hs4503711 Length=806 Score = 33.9 bits (76), Expect = 0.069, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 674 QSDVWSFGVLLWEIFTLGGSPY 695 > Hs13186249 Length=785 Score = 33.9 bits (76), Expect = 0.069, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 680 QSDVWSFGVLLWEIFTLGGSPY 701 > Hs13186251 Length=820 Score = 33.9 bits (76), Expect = 0.070, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 678 QSDVWSFGVLLWEIFTLGGSPY 699 > Hs11276087 Length=822 Score = 33.9 bits (76), Expect = 0.070, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 680 QSDVWSFGVLLWEIFTLGGSPY 701 > Hs4557695 Length=976 Score = 33.9 bits (76), Expect = 0.073, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 18 NAVPQAHSDLWSLGMLLYELFTGGNVPY 45 N V SD+WS G+ L+ELF+ G+ PY Sbjct 843 NCVYTFESDVWSYGIFLWELFSLGSSPY 870 > Hs13112052 Length=802 Score = 33.9 bits (76), Expect = 0.075, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 669 QSDVWSFGILLWEIFTLGGSPY 690 > Hs4503823 Length=537 Score = 33.9 bits (76), Expect = 0.079, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query 25 SDLWSLGMLLYELFTGGNVPYTE-DERDYLE 54 SD+WS G+LL EL T G VPY + R+ LE Sbjct 447 SDVWSFGILLTELVTKGRVPYPGMNNREVLE 477 > Hs13112050 Length=762 Score = 33.9 bits (76), Expect = 0.079, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 629 QSDVWSFGILLWEIFTLGGSPY 650 > Hs8923539 Length=542 Score = 33.9 bits (76), Expect = 0.085, Method: Composition-based stats. Identities = 13/16 (81%), Positives = 15/16 (93%), Gaps = 0/16 (0%) Query 25 SDLWSLGMLLYELFTG 40 SDLWSLG LLYE+F+G Sbjct 200 SDLWSLGCLLYEMFSG 215 > Hs18250298 Length=488 Score = 33.5 bits (75), Expect = 0.087, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+FT G PY Sbjct 407 SDVWSFGVLLHEVFTYGQCPY 427 > Hs21450846 Length=507 Score = 33.5 bits (75), Expect = 0.089, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%) Query 23 AHSDLWSLGMLLYELFTGGNVPY 45 + SD+WS G+LL+E+F+ G PY Sbjct 403 SKSDVWSFGVLLWEVFSYGRAPY 425 > Hs21450844 Length=466 Score = 33.5 bits (75), Expect = 0.090, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%) Query 23 AHSDLWSLGMLLYELFTGGNVPY 45 + SD+WS G+LL+E+F+ G PY Sbjct 362 SKSDVWSFGVLLWEVFSYGRAPY 384 > Hs21450842 Length=508 Score = 33.5 bits (75), Expect = 0.091, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%) Query 23 AHSDLWSLGMLLYELFTGGNVPY 45 + SD+WS G+LL+E+F+ G PY Sbjct 404 SKSDVWSFGVLLWEVFSYGRAPY 426 > Hs4885609 Length=536 Score = 33.5 bits (75), Expect = 0.092, Method: Compositional matrix adjust. Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL EL T G VPY Sbjct 445 KSDVWSFGILLTELTTKGRVPY 466 > Hs13186263 Length=769 Score = 33.5 bits (75), Expect = 0.095, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 24 HSDLWSLGMLLYELFTGGNVPY 45 SD+WS G+L++E+FT G PY Sbjct 684 QSDVWSFGVLMWEIFTLGGSPY 705 > Hs4758078 Length=450 Score = 33.5 bits (75), Expect = 0.098, Method: Compositional matrix adjust. Identities = 12/21 (57%), Positives = 18/21 (85%), Gaps = 0/21 (0%) Query 25 SDLWSLGMLLYELFTGGNVPY 45 SD+WS G+LL+E+++ G VPY Sbjct 367 SDVWSFGILLWEIYSFGRVPY 387 Lambda K H 0.316 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194096762 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40