bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2044_orf2 Length=83 Score E Sequences producing significant alignments: (Bits) Value 7301999 41.2 5e-04 At5g20650 40.0 0.001 7290736 38.9 0.003 CE07167 36.6 0.011 CE26194 35.4 0.029 YHR175w 35.0 0.030 CE09715 32.7 0.17 At5g59040 31.2 0.52 At2g37920_1 30.0 0.97 CE04331 29.6 1.6 Hs4503681 29.3 2.0 CE07826 26.9 9.1 > 7301999 Length=270 Score = 41.2 bits (95), Expect = 5e-04, Method: Composition-based stats. Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 0/46 (0%) Query 13 MEMQMTFYWGYDATILFPWWETSTALEFYLSCLCIFALCLGSAKLK 58 M M M F+ G TILF +W T +A+ LSCL IF + + LK Sbjct 61 MSMAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALK 106 > At5g20650 Length=146 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 0/34 (0%) Query 15 MQMTFYWGYDATILFPWWETSTALEFYLSCLCIF 48 M MTFYWG ATILF +W+T + L + L+ + F Sbjct 2 MHMTFYWGIKATILFDFWKTDSWLSYILTLIACF 35 > 7290736 Length=220 Score = 38.9 bits (89), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 0/44 (0%) Query 15 MQMTFYWGYDATILFPWWETSTALEFYLSCLCIFALCLGSAKLK 58 M M F++GY+ TILF WW T S + IF L L LK Sbjct 58 MPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLK 101 > CE07167 Length=162 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Query 13 MEMQMTFYWGYDATILFPWWETSTALEFYLSCLCIFALCLGSAKLK------AVCRDLQR 66 M+M MT ++G ILF WW+T + +S L F LC+ +K AV + +R Sbjct 1 MDMDMTLHFGEREKILFSWWKTGSLSGMAVSMLITFLLCILYEAIKSFRYFLAVWNNQKR 60 Query 67 GGAHVE 72 H E Sbjct 61 QQRHAE 66 > CE26194 Length=130 Score = 35.4 bits (80), Expect = 0.029, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query 17 MTFYWGYDATILFPWWETSTALEFYLSCLCIFALCLGSAKLKAVCRDLQRGGAHVEEP 74 M+F++G + TILF +W+T TA+ ++C L L+ RD ++ + +P Sbjct 1 MSFHFGTEETILFDFWKTETAVGIAVACFITVLLAFLMETLRFF-RDYRKAQTQLHQP 57 > YHR175w Length=189 Score = 35.0 bits (79), Expect = 0.030, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Query 14 EMQMTFYWGYDAT-ILFPWWETSTALEFYLSCLCIFALCLGSAKLKAVCRDLQRGGAHVE 72 M M F W Y T ++F WW T LSCL IF L LK C ++ V Sbjct 58 SMNMLFSWSYKNTCVVFEWWHIKTLPGLILSCLAIFGLAYLYEYLK-YCVHKRQLSQRVL 116 Query 73 EPARPVVR 80 P R + + Sbjct 117 LPNRSLTK 124 > CE09715 Length=252 Score = 32.7 bits (73), Expect = 0.17, Method: Compositional matrix adjust. Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 15 MQMTFYWGYDATILFPWWETSTALEFYLSCLCIFAL 50 M+M F+ G++ ILF +W T + LSC IF + Sbjct 76 MKMWFHGGFEEVILFDFWRTDSLFGMLLSCAAIFIM 111 > At5g59040 Length=151 Score = 31.2 bits (69), Expect = 0.52, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 15 MQMTFYWGYDATILFPWWETSTALEFYLSCLCI 47 M MTF+WG +LF W T+L+ Y CL + Sbjct 30 MHMTFFWGKTTEVLFDGWP-GTSLKMYWVCLAV 61 > At2g37920_1 Length=185 Score = 30.0 bits (66), Expect = 0.97, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 18 TFYWGYDATILFPWWETSTALEFYLSCLCIFALCL 52 TFYWGY+ +LF W S + L+ + +F L Sbjct 33 TFYWGYNCQVLFSGWPGSDRGMYALALIFVFFLAF 67 > CE04331 Length=178 Score = 29.6 bits (65), Expect = 1.6, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 14/18 (77%), Gaps = 0/18 (0%) Query 15 MQMTFYWGYDATILFPWW 32 M+M F+WG+D +LF +W Sbjct 118 MKMWFHWGFDEVVLFDFW 135 > Hs4503681 Length=5405 Score = 29.3 bits (64), Expect = 2.0, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 7/34 (20%) Query 46 CIFALCLGSAKLKAVCRDL-------QRGGAHVE 72 CIF LCLG L +C ++ Q G HVE Sbjct 1487 CIFDLCLGGGNLSILCSNIHAYVSACQAAGGHVE 1520 Score = 29.3 bits (64), Expect = 2.0, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 7/34 (20%) Query 46 CIFALCLGSAKLKAVCRDL-------QRGGAHVE 72 CIF LCLG L +C ++ Q G HVE Sbjct 2688 CIFDLCLGGGNLSILCSNIHAYVSACQAAGGHVE 2721 Score = 29.3 bits (64), Expect = 2.0, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 7/34 (20%) Query 46 CIFALCLGSAKLKAVCRDL-------QRGGAHVE 72 CIF LCLG L +C ++ Q G HVE Sbjct 3889 CIFDLCLGGGNLSILCSNIHAYVSACQAAGGHVE 3922 > CE07826 Length=922 Score = 26.9 bits (58), Expect = 9.1, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Query 32 WETSTALEFYLSCLCIFALC--LGSAKLKAVCRDLQ 65 W S ++FYL CIF + L S LK +C Q Sbjct 138 WSLSLEMQFYLFAPCIFFMLQFLNSKYLKVLCATRQ 173 Lambda K H 0.328 0.139 0.491 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1200681374 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40