bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1705_orf1 Length=177 Score E Sequences producing significant alignments: (Bits) Value At1g04080 52.8 3e-07 7301703 52.0 6e-07 SPBC4B4.09 44.3 1e-04 CE28000 42.7 3e-04 At5g46400 37.0 0.020 At1g51470 30.8 1.3 At2g21840 30.0 2.5 YPR152c 29.6 2.9 At1g47600 29.6 3.4 Hs7661952 29.3 4.2 7296050 28.9 5.7 At1g17760 28.9 6.3 CE28858 28.5 7.5 YBR150c 28.1 8.5 Hs22055433 28.1 9.3 At5g38690 28.1 9.4 > At1g04080 Length=768 Score = 52.8 bits (125), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 33/122 (27%), Positives = 62/122 (50%), Gaps = 5/122 (4%) Query 1 FWHPDPLAPRRLQAWRDYLDFEEKNAP-ERLPLLQRRCLEVCASYPELWLRCALQKKKSS 59 ++H PL L+ W +YLDF E++ ++ L RC+ CA+YPE W+R + S Sbjct 350 YFHVRPLNVAELENWHNYLDFIERDGDFNKVVKLYERCVVTCANYPEYWIRYVTNMEASG 409 Query 60 EEEALQLLHFAATKVLKRRRDMACIYASQL-EACGRLKEAAKEFEAL---VRPPLDSASL 115 + + AT+V +++ ++A++L E G + A ++ + + P L A + Sbjct 410 SADLAENALARATQVFVKKQPEIHLFAARLKEQNGDIAGARAAYQLVHSEISPGLLEAVI 469 Query 116 KY 117 K+ Sbjct 470 KH 471 > 7301703 Length=1009 Score = 52.0 bits (123), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Query 1 FWHPDPLAPRRLQAWRDYLDFE-EKNAPERLPLLQRRCLEVCASYPELWLR 50 ++H PL +L+ W+DYLDFE EK ER+ +L RCL CA Y E WL+ Sbjct 637 YFHVKPLERAQLKNWKDYLDFEIEKGDRERVLVLFERCLIACALYDEFWLK 687 > SPBC4B4.09 Length=612 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 10/88 (11%) Query 1 FWHPDPLAPRRLQAWRDYLDFEEKNAP-ERLPLLQRRCLEVCASYPELWLRCALQKKKSS 59 ++H L +L WR YLDFEE +R+ L RCL CA Y E W R A Sbjct 271 YFHVKELDEAQLVNWRKYLDFEEVEGDFQRICHLYERCLITCALYDEFWFRYARWMSAQP 330 Query 60 EEEALQLLHFAATKVLKRRRDMACIYAS 87 + H ++ R +CI+AS Sbjct 331 D-------HLNDVSIIYER--ASCIFAS 349 > CE28000 Length=710 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Query 1 FWHPDPLAPRRLQAWRDYLDFEEKNA-PERLPLLQRRCLEVCASYPELWLRCA 52 ++H PL +L W YLDFE K ER+ +L RCL C+ Y E W++ A Sbjct 373 YFHVKPLDYPQLFNWMSYLDFEIKEGHEERVKILFDRCLIPCSLYEEFWIKYA 425 > At5g46400 Length=1022 Score = 37.0 bits (84), Expect = 0.020, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query 1 FWHPDPLAPRRLQAWRDYLDFEEKNAPERLPL-LQRRCLEVCASYPELWLR 50 ++H PL +L W YL F E + L RCL CA+Y E W R Sbjct 287 YFHVKPLDTNQLDNWHAYLSFGETYGDFDWAINLYERCLIPCANYTEFWFR 337 > At1g51470 Length=465 Score = 30.8 bits (68), Expect = 1.3, Method: Compositional matrix adjust. Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 6/65 (9%) Query 94 RLKEAAKEFEALVRPPLDSASLKYFVALLQFSLRHPPETAADPLSHALLLLEEAADKYRD 153 RL E E ALV+ LD L Y+V+ Q++ PP T + ++ A + L YR+ Sbjct 282 RLPEFTPEESALVKGSLDFLGLNYYVS--QYATDAPPPTQPNAITDARVTL----GFYRN 335 Query 154 DGPCA 158 P Sbjct 336 GSPIG 340 > At2g21840 Length=746 Score = 30.0 bits (66), Expect = 2.5, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 49 LRCALQKKKSSEEEALQLLHFAATKVLKRRR 79 L CALQK ++ EA ++LH++ +LKR R Sbjct 106 LGCALQKNIATSWEAKEMLHYSHEHLLKRCR 136 > YPR152c Length=465 Score = 29.6 bits (65), Expect = 2.9, Method: Compositional matrix adjust. Identities = 26/131 (19%), Positives = 61/131 (46%), Gaps = 10/131 (7%) Query 26 APERLPLLQRRCLEVCASYPELWLRCALQKKKSSEEEALQLLHFAATKVLKRRRDMACI- 84 AP+ +P R+ + A Y ++ + K+ ++ QLL + T L++R+++ C Sbjct 308 APDTIPQDIRK--QQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDC 365 Query 85 -------YASQLEACGRLKEAAKEFEALVRPPLDSASLKYFVALLQFSLRHPPETAADPL 137 + +E+ + KE ++ L++ P DS+S++ + ++ P +P Sbjct 366 LRDHERDFTGAVESLRQDKELIDRWQTLLKAPADSSSIEDILLSIEHRCCVSPIVVTEPR 425 Query 138 SHALLLLEEAA 148 + + +LE+ Sbjct 426 YYVVGILEKTV 436 > At1g47600 Length=510 Score = 29.6 bits (65), Expect = 3.4, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query 94 RLKEAAKEFEALVRPPLDSASLKYFVALLQFSLRHPPETAADPLSHALLLL 144 RL E E ALV+ LD L Y+V Q++ PP T + ++ A + L Sbjct 327 RLPEFTPEQSALVKGSLDFLGLNYYVT--QYATDAPPPTQLNAITDARVTL 375 > Hs7661952 Length=963 Score = 29.3 bits (64), Expect = 4.2, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 11 RLQAWRDYLDFEEK-NAPERLPLLQRRCLEVCASYPELWLR 50 RL ++ Y+DFE K P R+ L+ R L P+LW+R Sbjct 309 RLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIR 349 > 7296050 Length=951 Score = 28.9 bits (63), Expect = 5.7, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 0/53 (0%) Query 55 KKKSSEEEALQLLHFAATKVLKRRRDMACIYASQLEACGRLKEAAKEFEALVR 107 +++ E+E L A +RR +A + S ++ GRLK+ K+ E L+R Sbjct 31 RQRDKEQEQQDLACLAKRDYTERRNGLAVLKNSGRKSTGRLKDNLKKLEDLLR 83 > At1g17760 Length=722 Score = 28.9 bits (63), Expect = 6.3, Method: Compositional matrix adjust. Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 15/72 (20%) Query 14 AWRDYLDFEEKN--------APERLPLLQRRCLEVCASYPELWLRCALQKKKSSEEEALQ 65 AW+ +L FE+ N + +R+ +CL YP++W A KS + Sbjct 227 AWKKFLSFEKGNPQRIDTASSTKRIIYAYEQCLMCLYHYPDVWYDYAEWHVKSGSTD--- 283 Query 66 LLHFAATKVLKR 77 AA KV +R Sbjct 284 ----AAIKVFQR 291 > CE28858 Length=968 Score = 28.5 bits (62), Expect = 7.5, Method: Compositional matrix adjust. Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query 9 PRRLQAWRDYLDFEEKNAPERLPLLQRRCLEVCASYPELWLRCA 52 P ++ W+ ++ E+ PE +L R +E C+S E+WL A Sbjct 427 PSSVKLWKAAVELED---PEDARILLTRAVECCSSSTEMWLALA 467 > YBR150c Length=1094 Score = 28.1 bits (61), Expect = 8.5, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 0/54 (0%) Query 124 FSLRHPPETAADPLSHALLLLEEAADKYRDDGPCAEVLHNYRAKLVALHAGDTK 177 FS+R + D + +L ++A D+ RDD P L NY+ + L +K Sbjct 621 FSIRTTLDDTLDEIIENVLENQKALDRMRDDLPTILSLENYKENMRILSLDSSK 674 > Hs22055433 Length=1416 Score = 28.1 bits (61), Expect = 9.3, Method: Composition-based stats. Identities = 26/97 (26%), Positives = 50/97 (51%), Gaps = 11/97 (11%) Query 11 RLQAWRDYLDFEEKNAPERLPLLQRRCLEVCASYPELWLRCALQKKKSSEEEALQLLHFA 70 + +A + L+ + + E+L L R+ EVC +KK+ S ++ +LLHF+ Sbjct 1228 KYKATKSDLETQISSLNEKLANLNRKYEEVCEEV------LHAKKKEISAKDEKELLHFS 1281 Query 71 ATKVL---KRRRDMACIYASQLEACGRLKEAAKEFEA 104 + + K R D + ++L+ R++E+AK+ EA Sbjct 1282 IEQEIKDQKERCDKSLTTITELQR--RIQESAKQIEA 1316 > At5g38690 Length=544 Score = 28.1 bits (61), Expect = 9.4, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 0/60 (0%) Query 45 PELWLRCALQKKKSSEEEALQLLHFAATKVLKRRRDMACIYASQLEACGRLKEAAKEFEA 104 PE++ + Q +K + + L+LL+F + L CI + +E+ R KEA ++ A Sbjct 354 PEMFEKGISQYEKLNSSKRLKLLNFLCDETLGTLVMRNCIDSQNIESVERKKEAKEKINA 413 Lambda K H 0.322 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2743263016 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40