bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1642_orf1 Length=82 Score E Sequences producing significant alignments: (Bits) Value Hs4506903 60.1 1e-09 Hs5902076 55.8 2e-08 CE24139 55.1 3e-08 At3g49430 50.4 7e-07 CE17724 50.4 8e-07 At1g09140 48.1 3e-06 Hs22067016 47.4 6e-06 7300132 47.4 6e-06 CE04155 46.2 1e-05 7296892 45.1 3e-05 At4g02430 45.1 3e-05 At1g02840 43.5 1e-04 7299363 43.1 1e-04 Hs19923399 43.1 1e-04 7295357 43.1 1e-04 CE27875 43.1 1e-04 At4g12630 43.1 1e-04 7299789 42.7 1e-04 At5g12190 42.7 1e-04 At1g23860 42.7 2e-04 At4g03110 42.7 2e-04 CE07598 42.4 2e-04 7299790 42.4 2e-04 7292872 42.0 2e-04 Hs7706326 41.6 3e-04 At2g24590 41.6 4e-04 Hs8922073 41.2 5e-04 Hs7657504 41.2 5e-04 At5g58790_2 41.2 5e-04 Hs5031703 41.2 5e-04 CE29008 40.8 5e-04 At4g31580 40.8 5e-04 At5g04600 40.8 7e-04 At3g52380 40.4 7e-04 At5g58470 40.4 8e-04 CE02067 40.4 8e-04 CE28093 40.4 8e-04 Hs7657383 40.4 9e-04 At1g60900 40.4 9e-04 CE28352 40.0 0.001 Hs22060967 39.7 0.001 Hs20559158 39.3 0.002 CE25105 39.3 0.002 7299058 39.3 0.002 CE03763 38.9 0.002 At4g36690 38.9 0.002 At5g60980 38.9 0.002 Hs22042102 38.9 0.002 At1g03457 38.9 0.003 At2g46610 38.5 0.003 > Hs4506903 Length=221 Score = 60.1 bits (144), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 29/49 (59%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP DV E++++DLFYK+GRIR+IE+K +R FAFV F+D Sbjct 15 RIYVGNLPTDVREKDLEDLFYKYGRIREIELK-NRHGLVPFAFVRFEDP 62 Score = 27.3 bits (59), Expect = 6.1, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAI 31 IR+IE+K +R FAFV F+D +DAI Sbjct 40 IREIELK-NRHGLVPFAFVRFEDPRDAEDAI 69 > Hs5902076 Length=248 Score = 55.8 bits (133), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 25/49 (51%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP D+ ++++D+FYK+G IRDI++K +R+ FAFV F+D Sbjct 17 RIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLK-NRRGGPPFAFVEFEDP 64 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAI 31 IRDI++K +R+ FAFV F+D +DA+ Sbjct 42 IRDIDLK-NRRGGPPFAFVEFEDPRDAEDAV 71 > CE24139 Length=235 Score = 55.1 bits (131), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 25/49 (51%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +++YVGNLP DV E+EV+D+F+K+GRI+ +++K R +FAFV F+D Sbjct 9 QKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRG--PAFAFVEFED 55 > At3g49430 Length=243 Score = 50.4 bits (119), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFD 79 +YVGNLP D+ E E++D+FYK+GRI DIE+K + + FV F+ Sbjct 9 IYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPR-PPCYCFVEFE 53 > CE17724 Length=520 Score = 50.4 bits (119), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 0/52 (0%) Query 28 DDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFD 79 D+A L+VGN+P DV ERE+ +F + G++ ++++K D ++AFV+F Sbjct 165 DEATRTLFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINTDAAYAFVMFQ 216 > At1g09140 Length=253 Score = 48.1 bits (113), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 +YVGNLP D+ + EV+DLFYK+G I DI++K + +AFV F+D Sbjct 9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRP-PGYAFVEFEDP 55 > Hs22067016 Length=143 Score = 47.4 bits (111), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 25/44 (56%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Query 37 GNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 GNLP V E+E DLFYK+ RIR+IE+K SR FA V F+D Sbjct 33 GNLPTHVREKEPQDLFYKYSRIREIELK-SRYGLVPFASVRFED 75 > 7300132 Length=255 Score = 47.4 bits (111), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 22/48 (45%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 R+YVGNLP D+ +++ DLF+KFG++ +++K R FAFV F+D Sbjct 8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRG--PPFAFVEFED 53 > CE04155 Length=179 Score = 46.2 bits (108), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/48 (45%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 ++YVG LP D T +E++++F +FGRIR + V R FAFV +DD Sbjct 4 KVYVGGLPSDATSQELEEIFDRFGRIRKVWVAR---RPPGFAFVEYDD 48 > 7296892 Length=416 Score = 45.1 bits (105), Expect = 3e-05, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 24/34 (70%), Gaps = 0/34 (0%) Query 28 DDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDI 61 D I LYVGNLP ++TE E+ D FY+FG IR I Sbjct 226 DRNITTLYVGNLPEEITEPELRDQFYQFGEIRSI 259 > At4g02430 Length=294 Score = 45.1 bits (105), Expect = 3e-05, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +YVGNLP D+ EREV+DLF K+G + I++K + +AFV F+D Sbjct 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPR-PPGYAFVEFED 54 > At1g02840 Length=283 Score = 43.5 bits (101), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/43 (48%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFV 76 +YVGNLP D+ EREV+DLF K+G + I++K + +AFV Sbjct 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRP-PGYAFV 50 > 7299363 Length=135 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Query 24 KYSVDDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 +Y D ++YVGNL ++ E++ F K+G +R++ V R N FAFV F+D+ Sbjct 3 RYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVAR---NPPGFAFVEFEDR 57 > Hs19923399 Length=482 Score = 43.1 bits (100), Expect = 1e-04, Method: Composition-based stats. Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEV--KRSRKNDTSFAFVVFDD 80 +L+VGNLP+D+ E E+ + F FG + ++ + K +F FVVFDD Sbjct 332 QLFVGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDD 381 > 7295357 Length=121 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 23/47 (48%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 LYV NLPY +T E+ D+F KFG IR I V + + + AFVV++D Sbjct 17 LYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGT-AFVVYED 62 > CE27875 Length=215 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 LY+ NLPY +T E+ ++F KFG +R I V + + + AFVV++D Sbjct 21 LYIKNLPYKITTEEMYEIFGKFGAVRQIRVGNTAETRGT-AFVVYED 66 > At4g12630 Length=109 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFD 79 L+VGNLP+ + ERE+ D F +FG + + + R S+AFV F+ Sbjct 16 HLWVGNLPHGILERELADRFLRFGELESLAFQPGR----SYAFVNFN 58 > 7299789 Length=329 Score = 42.7 bits (99), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 6/48 (12%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 R+YVG LPY V ER+++ F +GR RDI +K + FV F+D Sbjct 5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIK------NGYGFVEFED 46 > At5g12190 Length=124 Score = 42.7 bits (99), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDKY 82 LYV NLP+++T E+ D+F K+G IR I + + + AFVV++D Y Sbjct 21 LYVRNLPFNITSEEMYDIFGKYGAIRQIRIGCDKATKGT-AFVVYEDIY 68 > At1g23860 Length=174 Score = 42.7 bits (99), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 3/51 (5%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 + R+YVGNL VTERE++D F FG +R++ V R +AF+ FDD+ Sbjct 1 MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVAR---RPPGYAFLEFDDE 48 > At4g03110 Length=492 Score = 42.7 bits (99), Expect = 2e-04, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Query 24 KYSVDDAIERL----YVGNLPYDVTEREVDDLFYKFGRIRDIEVKR-SRKNDTSFAFVVF 78 KY+ D +ERL +VG LP +V+E EV LF K+G I+D+++ R +++ AF+ + Sbjct 95 KYA-DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKY 153 Query 79 DDK 81 + K Sbjct 154 ETK 156 > CE07598 Length=351 Score = 42.4 bits (98), Expect = 2e-04, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 0/47 (0%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFD 79 R+YV N+P+ E+++ +F+ +GR+ +E+ + + F FV D Sbjct 52 RIYVSNIPFSFREQDLAAMFFAYGRVLSVEIVTNDRGSKGFGFVTLD 98 > 7299790 Length=132 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 6/48 (12%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 R+YVG LPY V ER+++ F +GR RDI +K + FV F+D Sbjct 5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIK------NGYGFVEFED 46 > 7292872 Length=130 Score = 42.0 bits (97), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Query 24 KYSVDDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 +Y D ++YVGNL ++ E+++ F K+G +R++ V R N FAFV F+D+ Sbjct 3 RYREWDLACKVYVGNLGSSASKYEIENAFSKYGPLRNVWVAR---NPPGFAFVEFEDR 57 > Hs7706326 Length=125 Score = 41.6 bits (96), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 LY+ NLPY +T E+ D+F K+G IR I V + + + A+VV++D Sbjct 21 LYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGT-AYVVYED 66 > At2g24590 Length=196 Score = 41.6 bits (96), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 + R+YVGNL VTERE++D F FG IR + V R +AF+ F+D Sbjct 1 MSRVYVGNLDPRVTERELEDEFRSFGVIRSVWVAR---RPPGYAFLDFED 47 > Hs8922073 Length=377 Score = 41.2 bits (95), Expect = 5e-04, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 31/49 (63%), Gaps = 0/49 (0%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +RL+V N+P+ + ++ +F +FG+I D+E+ + + F FV F++ Sbjct 97 KRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFEN 145 > Hs7657504 Length=367 Score = 41.2 bits (95), Expect = 5e-04, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 31/49 (63%), Gaps = 0/49 (0%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +RL+V N+P+ + ++ +F +FG+I D+E+ + + F FV F++ Sbjct 112 KRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFEN 160 > At5g58790_2 Length=161 Score = 41.2 bits (95), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 2/50 (4%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFVVFDDK 81 +YVG LPYD+TE ++ +F ++G + D+ + R + S FAFV ++D+ Sbjct 32 VYVGELPYDLTEGDLLAVFSQYGEVVDLNLVRDKGTGRSKRFAFVAYEDQ 81 > Hs5031703 Length=466 Score = 41.2 bits (95), Expect = 5e-04, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +L++GNLP++V + E+ D F +G + ++ + K +F FVVFDD Sbjct 341 QLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKL-PNFGFVVFDD 387 > CE29008 Length=305 Score = 40.8 bits (94), Expect = 5e-04, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 35/52 (67%), Gaps = 2/52 (3%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIE--VKRSRKNDTSFAFVVFDDK 81 ++++VG LP D +E+++ F +FG++ DIE + K +FAF+VF+++ Sbjct 110 KKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEE 161 Score = 30.0 bits (66), Expect = 0.95, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFVVF 78 ++++VG + +V ++ F ++G + +VK R N S FAFV F Sbjct 29 KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEF 77 > At4g31580 Length=200 Score = 40.8 bits (94), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 + R+YVGNL VTERE++D F FG +R + V R +AF+ F+D Sbjct 1 MSRVYVGNLDPRVTERELEDEFRAFGVVRSVWVAR---RPPGYAFLDFEDP 48 > At5g04600 Length=222 Score = 40.8 bits (94), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFVVFDD 80 LY+G +P+ E E++ F +FG ++ + V R++K S F F+ F+D Sbjct 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFED 110 > At3g52380 Length=329 Score = 40.4 bits (93), Expect = 7e-04, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFV 76 RLYVGNLPY +T E+ +F + G + D+++ + D S F FV Sbjct 117 RLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFV 162 > At5g58470 Length=493 Score = 40.4 bits (93), Expect = 8e-04, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+Y+ NLP DVT E+ DLF G++ I+ KR K+ + ++ D+ Sbjct 281 RIYISNLPPDVTTDELKDLFGGIGQVGRIKQKRGYKDQWPYNIKIYTDE 329 > CE02067 Length=208 Score = 40.4 bits (93), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 + RLY+G +PY+ ER+V+ +G+I +I +K FAFV F+D Sbjct 1 MPRLYLGKIPYNCHERDVERFLKGYGKINNISMK------YGFAFVDFED 44 > CE28093 Length=166 Score = 40.4 bits (93), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 + RLY+G +PY+ ER+V+ +G+I +I +K FAFV F+D Sbjct 1 MPRLYLGKIPYNCHERDVERFLKGYGKINNISMK------YGFAFVDFED 44 > Hs7657383 Length=471 Score = 40.4 bits (93), Expect = 9e-04, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 RL+VGNLP D+TE E+ LF K+G+ ++ + + D F F+ + + Sbjct 75 RLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHK----DKGFGFIRLETR 119 > At1g60900 Length=568 Score = 40.4 bits (93), Expect = 9e-04, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRK--NDTSFAFVVFDD 80 +R++VG LPY TE ++ +L FG +R + + R+ N +AF V+ D Sbjct 354 DRIFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQD 404 > CE28352 Length=208 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 + RLY+G +PY+ ER+V+ +G+I +I +K FAFV F+D Sbjct 1 MPRLYLGKIPYNCHERDVERFLKGYGKINNISMK------YGFAFVDFED 44 > Hs22060967 Length=271 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Query 30 AIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDT--SFAFVVFDD 80 +++L+VG + D E + D F K+G+I IE+ R++ FAFV FDD Sbjct 58 GVKKLFVGGIKEDTEEYNLRDYFEKYGKIETIEIMEDRQSGKKRGFAFVTFDD 110 > Hs20559158 Length=330 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDT-SFAFVVFD 79 +YV NLP DV E+ + DLF +FG++ ++V R + F FV F+ Sbjct 193 IYVKNLPVDVDEQGLQDLFSQFGKMLSVKVMRDNSGHSRCFGFVNFE 239 > CE25105 Length=415 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 0/51 (0%) Query 29 DAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFD 79 D +RL+V N+P+ + ++ +F KFG + D+E+ + + F FV + Sbjct 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNERGSKGFGFVTME 200 > 7299058 Length=91 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFVVFDDK 81 +L+VGNLP+ + +E+ F K+G + + EV R+ S + FVVF + Sbjct 11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQR 61 > CE03763 Length=312 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 6/49 (12%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+Y+G L V+E++++ F +G+IRD+ +K F FV FDDK Sbjct 4 RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLK------NGFGFVEFDDK 46 > At4g36690 Length=573 Score = 38.9 bits (89), Expect = 0.002, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRK--NDTSFAFVVFDD 80 +R++VG LPY TE +V +L FG ++ ++ + R+ N +AF V+ D Sbjct 359 DRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQD 409 > At5g60980 Length=459 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Query 27 VDDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVK-RSRKNDTSFAFVVFD 79 V+D +YV NLP+D T +++++F FG I+ ++ RS K F FV F+ Sbjct 288 VEDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQGFCFGFVEFE 341 > Hs22042102 Length=378 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Query 30 AIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDT--SFAFVVFDD 80 +++++VG + D E + D F K+G+I IEV R++ FAFV FDD Sbjct 124 TVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176 Score = 30.4 bits (67), Expect = 0.83, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 10/56 (17%) Query 29 DAIERLYVGNLPYDVTEREVDDLFYKFGRI------RDIEVKRSRKNDTSFAFVVF 78 + + +L++G L ++ T+ + + F K+G + RD + KRSR F FV + Sbjct 32 EQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSR----GFGFVTY 83 > At1g03457 Length=453 Score = 38.9 bits (89), Expect = 0.003, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKR-SRKNDTSFAFVVFDDK 81 +L+VG LP +V+E EV LF ++G I+D+++ R S + F+ ++ K Sbjct 110 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESK 159 > At2g46610 Length=250 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 6/51 (11%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 + +YVGN YD +++ LF KFGR++ +++K + +AFV F+D+ Sbjct 1 MRHVYVGNFDYDTRHSDLERLFSKFGRVKRVDMK------SGYAFVYFEDE 45 Lambda K H 0.324 0.143 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1159278568 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40