bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1477_orf1 Length=81 Score E Sequences producing significant alignments: (Bits) Value At3g07090 45.8 2e-05 ECU09g0690 44.3 5e-05 CE28391 40.4 8e-04 At5g47310 39.7 0.001 At4g17486 38.9 0.002 At4g31980_1 38.5 0.003 Hs7705642 38.5 0.003 SPAPYUG7.06 38.1 0.004 At5g25170 37.7 0.005 Hs18589856 37.7 0.006 At2g25190 37.0 0.008 At1g80690 37.0 0.009 7303700 37.0 0.009 At4g25680 35.0 0.033 At1g47740 35.0 0.035 At4g25660 34.7 0.040 Hs14779199 31.6 0.41 7293595 30.8 0.57 Hs9966859 29.6 1.4 At1g35730 28.5 3.4 Hs20545248 28.1 3.9 CE16530 27.3 6.7 > At3g07090 Length=265 Score = 45.8 bits (107), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Query 14 YGMTPKKIEELGETTKTPQEI-QSFLSSVSPRFTAETYDLLHNNCNHFTQAAA 65 YG TP + ELG + P+++ + +L +SPR+TAE+Y+LL +NCN+F+ A Sbjct 63 YG-TPIRTIELG-LSHVPKDVFEMYLEEISPRYTAESYNLLTHNCNNFSNEVA 113 > ECU09g0690 Length=150 Score = 44.3 bits (103), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query 12 SLYGMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQAAA 65 ++YG TP KI +LG T + FL S++ F Y LL NNCN+FT A Sbjct 59 TIYG-TPLKIHDLGATDIPEVVFEDFLFSIAEDFAPHKYHLLKNNCNNFTNTLA 111 > CE28391 Length=334 Score = 40.4 bits (93), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 12/71 (16%) Query 7 PSEIESLYGMTPKKIEELGETTKTPQ------------EIQSFLSSVSPRFTAETYDLLH 54 P + ++ +P+ EELGET K + +I+ + S+ F + Y L+ Sbjct 71 PYQFSGVFENSPQDAEELGETFKFKESIVVGETERSTSDIRKLIKSLGEDFRGDRYHLIS 130 Query 55 NNCNHFTQAAA 65 NCNHF+ A Sbjct 131 RNCNHFSAVLA 141 > At5g47310 Length=245 Score = 39.7 bits (91), Expect = 0.001, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 24 LGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQ 62 LG T+ + + +SF+ +S ++ +TY L+ NCNHFT+ Sbjct 94 LGTTSMSRSDFRSFMEKLSRKYHGDTYHLIAKNCNHFTE 132 > At4g17486 Length=246 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 0/51 (0%) Query 15 GMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQAAA 65 G ++ LG T+ + + +S++ +S ++ +TY L+ NCNHFT+ Sbjct 105 GFIFRRSVLLGTTSMSRSDFRSYMEKLSRKYHGDTYHLIAKNCNHFTEEVC 155 > At4g31980_1 Length=266 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 0/46 (0%) Query 15 GMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHF 60 G T +K +GET +E++SF+ +S + Y L+ NCNHF Sbjct 74 GFTFRKSILVGETEMKAKEVRSFMEKLSEEYQGNKYHLITRNCNHF 119 > Hs7705642 Length=193 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 12/69 (17%) Query 7 PSEIESLYGMTPKKIEELGETTKTPQ------------EIQSFLSSVSPRFTAETYDLLH 54 P ++ ++P ELGET K + +I+ + + + Y L+H Sbjct 46 PYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMH 105 Query 55 NNCNHFTQA 63 NCNHF+ A Sbjct 106 KNCNHFSSA 114 > SPAPYUG7.06 Length=191 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 0/39 (0%) Query 33 EIQSFLSSVSPRFTAETYDLLHNNCNHFTQAAAAAAAAS 71 ++ L +S FT +Y LL NCNHFT AAA S Sbjct 71 DVDRILIRLSQEFTGLSYSLLERNCNHFTNAAAIELTGS 109 > At5g25170 Length=211 Score = 37.7 bits (86), Expect = 0.005, Method: Compositional matrix adjust. Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 0/58 (0%) Query 15 GMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQAAAAAAAASS 72 G T +K +G T P+ ++ F+ ++ ++ +Y L+ NCNHF S Sbjct 68 GFTFRKSILIGRTDLDPENVRVFMEKLAEEYSGNSYHLITKNCNHFCNDVCVQLTRRS 125 > Hs18589856 Length=154 Score = 37.7 bits (86), Expect = 0.006, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Query 18 PKKIEE--LGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQAAAAAAAASSNSN 75 P K +E LG T +I+ + + + Y L+H NCNHF+ A + S+ + Sbjct 66 PFKFKEVVLGSTDFLEDDIEKIVEELGKEYKGNVYHLMHKNCNHFSSALSEQKLESNEGH 125 Query 76 R 76 Sbjct 126 H 126 > At2g25190 Length=240 Score = 37.0 bits (84), Expect = 0.008, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 0/58 (0%) Query 15 GMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQAAAAAAAASS 72 G T +K +G+T +E++ F+ ++ + Y L+ NCNHF A S Sbjct 74 GFTFRKSILVGKTDLVAKEVRVFMEKLAEEYQGNKYHLITRNCNHFCNEVCLKLAQKS 131 > At1g80690 Length=231 Score = 37.0 bits (84), Expect = 0.009, Method: Compositional matrix adjust. Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 3/62 (4%) Query 1 GVVYMPPSEIESLYGMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHF 60 G+ P + E G T +K +G+T P E+++ + ++ + +Y+L+ NCNHF Sbjct 61 GIFEGEPKQCE---GFTFRKSILIGKTDLGPLEVRATMEQLADNYKGSSYNLITKNCNHF 117 Query 61 TQ 62 Sbjct 118 CD 119 > 7303700 Length=205 Score = 37.0 bits (84), Expect = 0.009, Method: Compositional matrix adjust. Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 12/67 (17%) Query 7 PSEIESLYGMTPKKIEELGE------------TTKTPQEIQSFLSSVSPRFTAETYDLLH 54 P ++ ++P+ +ELG+ T T +E++ + + +F + Y L++ Sbjct 78 PFPFTGVFEISPRDHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMN 137 Query 55 NNCNHFT 61 NNCNHF+ Sbjct 138 NNCNHFS 144 > At4g25680 Length=252 Score = 35.0 bits (79), Expect = 0.033, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query 3 VYMPPSEIESLYGMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHF 60 V+ PS +Y K + LG+T T + L +S + TYDLL NCNHF Sbjct 63 VFSCPSGKNPMYTYREKIV--LGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF 118 > At1g47740 Length=279 Score = 35.0 bits (79), Expect = 0.035, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 15 GMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQ 62 G KK +G T P +++ F+ ++ + Y L+ NCNHF Q Sbjct 126 GFKFKKSIFIGTTNLNPTQVREFMEDMACSYYGNMYHLIVKNCNHFCQ 173 > At4g25660 Length=255 Score = 34.7 bits (78), Expect = 0.040, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query 3 VYMPPSEIESLYGMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHF 60 V+ PS +Y K + LG+T T + L +S + TYDLL NCNHF Sbjct 63 VFSCPSGKNPMYTYREKIV--LGKTDCTIFMVNQILRELSREWPGHTYDLLSKNCNHF 118 > Hs14779199 Length=168 Score = 31.6 bits (70), Expect = 0.41, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query 18 PKKIEELGETTKTPQEIQSFLSSVSPR-FTAETYDLLHNNCNHFTQAAA 65 P + ++G T T + +LSS+ F E Y+L +NCN F+ A Sbjct 68 PDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVA 116 > 7293595 Length=183 Score = 30.8 bits (68), Expect = 0.57, Method: Compositional matrix adjust. Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 0/47 (0%) Query 24 LGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQAAAAAAAA 70 LG T T E++ ++ + F +Y L NCNHF+ A Sbjct 98 LGYTDFTCAEVKRVINLLGFEFRGTSYHLTSKNCNHFSNCLAHLVCG 144 > Hs9966859 Length=168 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 0/32 (0%) Query 50 YDLLHNNCNHFTQAAAAAAAASSNSNRTTAAV 81 Y+LL NNC HF S +NR + V Sbjct 112 YNLLVNNCEHFVTLLRYGEGVSEQANRAISTV 143 > At1g35730 Length=564 Score = 28.5 bits (62), Expect = 3.4, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Query 21 IEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNNCNHFTQAAAAAAAASSNSNRTTAA 80 ++++ ET KT Q+I S + P F A DL N NH Q+ + N AA Sbjct 342 VQKMIETVKTKQQIALVKSGLKPGFLALVKDL---NGNHVIQSCLQTLGPNDNEFVLEAA 398 > Hs20545248 Length=120 Score = 28.1 bits (61), Expect = 3.9, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 5/66 (7%) Query 10 IESLYGMTPKKIEELGETTKTPQEIQSFLSSVSPRFTAETYDLLHNN----CNHFTQAAA 65 +E L G TPK + LGE KT Q+ + P F + + H NH T A Sbjct 10 LEPLQG-TPKWVPVLGELQKTLQKGEYLPLRPLPMFESNFVQVTHQGGPVFVNHRTNRLA 68 Query 66 AAAAAS 71 AAS Sbjct 69 MGVAAS 74 > CE16530 Length=307 Score = 27.3 bits (59), Expect = 6.7, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 20/27 (74%), Gaps = 0/27 (0%) Query 26 ETTKTPQEIQSFLSSVSPRFTAETYDL 52 + T++ +++SF ++++PRFTA T L Sbjct 84 DRTRSTVDVRSFTTTINPRFTAATKRL 110 Lambda K H 0.308 0.120 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1162440328 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40