bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0334_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value Hs20149304 60.5 1e-09 At3g18790 58.9 3e-09 7298990 58.9 3e-09 CE05922 57.4 8e-09 SPBC32F12.05c 41.6 5e-04 > Hs20149304 Length=285 Score = 60.5 bits (145), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Query 8 YYYFGAAKELPGVRELFAGRAEEINEPRKTRAQLFQRITPDYFGWRDEENEDLLLAEQQQ 67 Y YFGAAK+LPGVRELF E + PRKTRA+L + I +Y+G+ DE++ ++ EQ+ Sbjct 120 YKYFGAAKDLPGVRELF--EKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEY 177 Query 68 EQ 69 E+ Sbjct 178 EK 179 > At3g18790 Length=300 Score = 58.9 bits (141), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 40/103 (38%), Positives = 63/103 (61%), Gaps = 2/103 (1%) Query 5 GGDYYYFGAAKELPGVRELFAGRAEEINEPRKTRAQLFQRITPDYFGWRDEENEDLLLAE 64 G Y YFGAAK+LPGVRELF + E+ + RKTR +++RI Y+G+RD+E+ L E Sbjct 124 GPGYRYFGAAKKLPGVRELFE-KPPELRK-RKTRYDIYKRIDASYYGYRDDEDGILEKLE 181 Query 65 QQQEQLWQQQQEEELQQQQELLESVGAASAAAAAKGMAAAAER 107 ++ E +++ EE ++ E+ + ++ + G AAAA R Sbjct 182 RKSEGGMRKRSVEEWRRLDEVRKEARKGASEVVSVGAAAAAAR 224 > 7298990 Length=274 Score = 58.9 bits (141), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 30/62 (48%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Query 8 YYYFGAAKELPGVRELFAGRAEEINEPRKTRAQLFQRITPDYFGWRDEENEDLLLAEQQQ 67 Y YFGAAK+LPGVRELF + PRK+RA+L + I +Y+G+RD+E+ L+ E++ Sbjct 122 YKYFGAAKDLPGVRELFE--QDPPPPPRKSRAELMKDIDAEYYGYRDDEDGVLIPLEERI 179 Query 68 EQ 69 E+ Sbjct 180 ER 181 > CE05922 Length=267 Score = 57.4 bits (137), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 6/81 (7%) Query 8 YYYFGAAKELPGVRELFAGRAEEINEPRKTRAQLFQRITPDYFGWRDEENEDL-----LL 62 Y YFGAAK+LPGVRELF ++ E E R+ RA L + I YFG+ D+E+ L L+ Sbjct 121 YKYFGAAKDLPGVRELFE-KSTEGEEQRRHRADLLRNIDAHYFGYLDDEDGRLIPLEKLI 179 Query 63 AEQQQEQLWQQQQEEELQQQQ 83 E+ E++ ++ E++ Q+QQ Sbjct 180 EEKNIERINKEFAEKQAQKQQ 200 > SPBC32F12.05c Length=217 Score = 41.6 bits (96), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 10/72 (13%) Query 7 DYYYFGAAKELPGVRELFAGRAEEINEPRKTRAQLFQRITPD--YFGWRDEENEDLL--- 61 DY Y+G A+ELPGV+ELF I P + R Q Q+ D YFG+ E LL Sbjct 106 DYRYYGRARELPGVKELFEADMSFI--PERQRKQEMQKRRLDAWYFGYIPPAQESLLEDF 163 Query 62 ---LAEQQQEQL 70 + EQQ + L Sbjct 164 EAKIEEQQHKHL 175 Lambda K H 0.310 0.126 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1498437086 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40