bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0016_orf1 Length=158 Score E Sequences producing significant alignments: (Bits) Value Hs4503505 86.3 2e-17 At5g20920 84.7 6e-17 7294562 78.6 5e-15 CE16227 75.1 6e-14 SPAC6B12.17c 68.6 5e-12 At3g07920 61.2 7e-10 YPL237w 60.1 2e-09 At5g01940 50.1 2e-06 At5g22810 36.2 0.025 > Hs4503505 Length=333 Score = 86.3 bits (212), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 36/69 (52%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Query 92 SYEEMLSRIQDLIVKNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 +YEE+L+R+ +++ + NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR + Sbjct 175 TYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPK 234 Query 150 HVLQFVLAE 158 H+L F+LAE Sbjct 235 HLLAFLLAE 243 > At5g20920 Length=268 Score = 84.7 bits (208), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 33/67 (49%), Positives = 53/67 (79%), Gaps = 1/67 (1%) Query 93 YEEMLSRIQDLIVKNNPDLAGSKRYTI-KPPQVVRVGSKKVAWINFKDICGIMHRPSEHV 151 Y+E+L R+ +++ +NNP+LAG +R T+ +PPQV+R G+KK ++NF D+C MHR +HV Sbjct 118 YDELLGRVFNILRENNPELAGDRRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPDHV 177 Query 152 LQFVLAE 158 +Q++LAE Sbjct 178 MQYLLAE 184 > 7294562 Length=312 Score = 78.6 bits (192), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 33/82 (40%), Positives = 54/82 (65%), Gaps = 2/82 (2%) Query 79 DGSGQLFIRGHVCSYEEMLSRIQDLIVKNNPDLAGSKR--YTIKPPQVVRVGSKKVAWIN 136 D S F +Y+E+L R+ ++I+ NPD+A ++ + ++PPQV+RVG+KK ++ N Sbjct 141 DNSSTWFGSDRDYTYDELLKRVFEIILDKNPDMAAGRKPKFVMRPPQVLRVGTKKTSFAN 200 Query 137 FKDICGIMHRPSEHVLQFVLAE 158 F DI +HR +H+L F+LAE Sbjct 201 FMDIAKTLHRLPKHLLDFLLAE 222 > CE16227 Length=250 Score = 75.1 bits (183), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query 92 SYEEMLSRIQDLIVKNNPDLAGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEH 150 +YEE L+ + ++ NPD AG K+ + IK P+V R GSKK A+ NF +IC +M R +H Sbjct 88 TYEEALTLVYQVMKDKNPDFAGDKKKFAIKLPEVARAGSKKTAFSNFLEICRLMKRQDKH 147 Query 151 VLQFVLAE 158 VLQF+LAE Sbjct 148 VLQFLLAE 155 > SPAC6B12.17c Length=310 Score = 68.6 bits (166), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 2/67 (2%) Query 93 YEEMLSRIQDLIVKNNPDLAGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEHV 151 Y E+L+R L+ NNP+LAG KR YTI PP V R G KK + N DI MHR +HV Sbjct 159 YPELLNRFFTLLRTNNPELAGEKRKYTIVPPSVHREG-KKTIFANISDISKRMHRSLDHV 217 Query 152 LQFVLAE 158 +QF+ AE Sbjct 218 IQFLFAE 224 > At3g07920 Length=169 Score = 61.2 bits (147), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 5/70 (7%) Query 94 EEMLSRIQDLIVKNNPDLAGSKRYTI-KPPQVVR----VGSKKVAWINFKDICGIMHRPS 148 +E+L R+ +++ +N+P+L G TI PPQV+R G+KK ++NF D C MHR Sbjct 17 QEILRRVFNILRENSPELVGIWLLTIIWPPQVLREETAKGTKKTVFVNFMDYCKTMHRNP 76 Query 149 EHVLQFVLAE 158 +HV+ F+LAE Sbjct 77 DHVMAFLLAE 86 > YPL237w Length=285 Score = 60.1 bits (144), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Query 93 YEEMLSRIQDLIVKNNPDLAGSK---RYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 Y E+LSR +++ NNP+LAG + ++ I PP +R G KK + N +DI +HR E Sbjct 131 YSELLSRFFNILRTNNPELAGDRSGPKFRIPPPVCLRDG-KKTIFSNIQDIAEKLHRSPE 189 Query 150 HVLQFVLAE 158 H++Q++ AE Sbjct 190 HLIQYLFAE 198 > At5g01940 Length=231 Score = 50.1 bits (118), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 23/67 (34%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Query 93 YEEMLSRIQDLIVKNNPDLAGSK-RYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEHV 151 Y+E+LS + D + + + +++ + R + PPQ++ G+ V +NF D+C MHR +HV Sbjct 75 YKELLSMVFDRLREEDVEVSTERPRTVMMPPQLLAEGTITVC-LNFADLCRTMHRKPDHV 133 Query 152 LQFVLAE 158 ++F+LA+ Sbjct 134 MKFLLAQ 140 > At5g22810 Length=337 Score = 36.2 bits (82), Expect = 0.025, Method: Compositional matrix adjust. Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Query 37 ATSAASSNISSKQQHQQQQQQQHRGLCVSLFAADAAAAEGFIDGSGQLF----IRGHVCS 92 AT + N+ K Q ++ +G + + A A+AA G+ DG+ +L+ + + Sbjct 59 ATDFTAENLGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEH 118 Query 93 YEEMLSRIQDLIVKNN 108 Y++ +SRIQ++ NN Sbjct 119 YKDYISRIQEIATSNN 134 Lambda K H 0.314 0.126 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2100092188 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40