bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0001_orf1 Length=262 Score E Sequences producing significant alignments: (Bits) Value CE05905 35.4 0.13 Hs22059237 34.3 0.28 At4g31470 32.3 1.0 YHR150w 31.6 1.8 Hs22059233 31.2 2.2 CE12290 31.2 2.2 CE05901 30.8 3.4 CE23800 30.4 3.4 > CE05905 Length=207 Score = 35.4 bits (80), Expect = 0.13, Method: Compositional matrix adjust. Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 159 LLWSQSTKIACAVGVCTDESPLPSGKEAILVCQFSPAAQENAAPFSKE 206 + W+ ++ I C V C ++ + + + +VCQ+SP P KE Sbjct 139 MAWANTSSIGCGVKNCGRDASMRNMNKIAVVCQYSPPGNTMGRPIYKE 186 > Hs22059237 Length=344 Score = 34.3 bits (77), Expect = 0.28, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Query 149 ANADGANLANLLWSQSTKIACAVGVCTDESPLPSGKEAILVCQFSPAAQENAAPFS 204 + D +N L+W S K+ CAV C+ + AI +C ++P P+ Sbjct 151 CSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHA--AIFICNYAPGGTLTRRPYE 204 > At4g31470 Length=185 Score = 32.3 bits (72), Expect = 1.0, Method: Compositional matrix adjust. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 7/54 (12%) Query 149 ANADGANLANLLWSQSTKIACAVGVCTDESPLPSGKEAILVCQFSPAAQENAAP 202 AN D + L+W +S++I CA+ C + ++C + P P Sbjct 137 ANGDCLHYTQLVWKKSSRIGCAISFCKTG-------DTFIICNYDPPGNIVGQP 183 > YHR150w Length=579 Score = 31.6 bits (70), Expect = 1.8, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 203 FSKEYYDVLHARNTPITEMTEADLKESSTGGAAAAVPSLL 242 FSK + D L +RN I E++E D + +TG + L+ Sbjct 315 FSKSFMDTLESRNQEIDEISELDKRTENTGELKQGMKVLI 354 > Hs22059233 Length=233 Score = 31.2 bits (69), Expect = 2.2, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Query 159 LLWSQSTKIACAVGVCTDESPLPSGKEAILVCQFSPAAQ-ENAAPFSK 205 L+W+ S + CAV +C + L AI VC + PA N P+ + Sbjct 141 LVWANSFYVGCAVAMCPN---LGGASTAIFVCNYGPAGNFANMPPYVR 185 > CE12290 Length=544 Score = 31.2 bits (69), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 0/51 (0%) Query 206 EYYDVLHARNTPITEMTEADLKESSTGGAAAAVPSLLFASLITTLAAVAYR 256 E D++ A + + E+T+ D+ GAA + SL+ S+ITTL A R Sbjct 135 ENTDIVCATLSLLRELTDDDVMNEGEDGAAELIESLVSGSIITTLLACVER 185 > CE05901 Length=212 Score = 30.8 bits (68), Expect = 3.4, Method: Compositional matrix adjust. Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query 159 LLWSQSTKIACAVGVCTDESPLPSGKEAILVCQFSPAAQ 197 + W+ + KI C + C+ +S G + ++VC +SPA Sbjct 147 MAWATTNKIGCGISKCSSDS---FGTQYVVVCLYSPAGN 182 > CE23800 Length=208 Score = 30.4 bits (67), Expect = 3.4, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 159 LLWSQSTKIACAVGVCTDESPLPSGKEAILVCQFSPAA 196 + W+++ KI C V C +S + + + +VCQ+ A Sbjct 140 MAWAETNKIGCGVKNCGKDSSMNNMYKVAVVCQYDQAG 177 Lambda K H 0.316 0.127 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 5542830696 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40