bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3406_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1320c 72.8 3e-12 > 5833.PFI1320c Length=225 Score = 72.8 bits (177), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 43/127 (33%), Positives = 60/127 (47%), Gaps = 10/127 (7%) Query 20 SFSHRTEMVRTKGFKFLRNLGGMGYTPNTQIRAGDERFGKNESRDLRTSACAFSQEKLQP 79 S R ++VR K K N G +GY NT + ++ K E R+ + C S+E L+ Sbjct 7 SLPQRVDLVRMKNKKLRENTGSLGYEKNTLVNVNQNKYNKKELREYHFNRCVISEELLKE 66 Query 80 PLLACRIGRLYNKEAVIKALLEKALPA---------HMKHVKSLKDMKEVQVDINAETGF 130 P CR+G LYNKE + LL K HV SLKD+ + +N E G Sbjct 67 PFFCCRLGYLYNKEHAFQLLLVKKQNKKKRKKDTFEKFAHVDSLKDLVLCKNKLNEE-GK 125 Query 131 PVCPITK 137 +C I+K Sbjct 126 LICLISK 132 Lambda K H 0.319 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40