bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3394_orf2 Length=156 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0490c 103 2e-21 > 5833.PFI0490c Length=1195 Score = 103 bits (256), Expect = 2e-21, Method: Composition-based stats. Identities = 56/159 (35%), Positives = 94/159 (59%), Gaps = 10/159 (6%) Query 7 LAQLLRCVEDGLCAQE-TVLMQSCATLGHFVEFIFKYRNSEEKEGDAV---------RAF 56 +A ++ V++GLC+ + TV M C+ L + V +IF R + ++G + + F Sbjct 1033 IADIIHNVKEGLCSFDYTVSMTCCSILDNIVTYIFTNRKNSTEQGQVINKNKHHMIIKNF 1092 Query 57 LEAQPGSLPRMLQLIFQLLMTGQLPNLFAISGVLLGLIVLQQNEYLKLKQQIIEQQIESK 116 LE+QP +L +L L+F L++ G + +++S LLGLI+L Y K+++Q+I QQ E K Sbjct 1093 LESQPQALKEVLNLMFHLILGGDFGSTWSMSQPLLGLILLDAQGYFKIQEQLISQQSEEK 1152 Query 117 RPQVEGFFIELMVNIEDDLTPANKDRFMRNLYQKATTSR 155 + ++ F +LM +IE +L P N++ F RNLY A R Sbjct 1153 KQKLRHSFCKLMDHIESNLAPNNRENFTRNLYTFAQEIR 1191 Lambda K H 0.323 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 24371502831 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40