bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3388_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_2400 125 5e-28 > 5807.cgd5_2400 Length=322 Score = 125 bits (313), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 58/121 (47%), Positives = 84/121 (69%), Gaps = 1/121 (0%) Query 1 PLASASIGQVHRAWLTDG-TAVVVKVQHADVESLLMHDMANLKQLSWAFGMLEQGMNFAP 59 P+A+ASI QVH+A L++G VV+K+Q+ +++ L HDM NL+QL+WAFG+LE + Sbjct 125 PIAAASISQVHKAVLSEGEKKVVIKIQYPNIQETLNHDMKNLEQLTWAFGLLEDYSDSIH 184 Query 60 ILEEWQKAASKELDFRFEYAHQTRAYEAAQRSGIGVIIPKCYQNLVTKSVMVMEFIDGFK 119 IL EW+ +A ELDF+ E +Q RAYE + SGI +IIPK Y T+ ++ ME+I GF Sbjct 185 ILNEWKSSAYSELDFKNELKNQKRAYEMFEDSGIEIIIPKVYTEYTTEKILTMEYIKGFN 244 Query 120 V 120 + Sbjct 245 I 245 Lambda K H 0.322 0.132 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40