bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3384_orf2 Length=146 Score E Sequences producing significant alignments: (Bits) Value 5085.AFUA_2G16640 63.9 1e-09 > 5085.AFUA_2G16640 Length=1017 Score = 63.9 bits (154), Expect = 1e-09, Method: Composition-based stats. Identities = 44/133 (33%), Positives = 57/133 (42%), Gaps = 26/133 (19%) Query 10 LLLLHGSVQQQVLHTQGVLLQLLTISRRSAAFAGPRYRKRGLNDAGDAANEVEVEFVCMA 69 L ++HG V Q + G L L I+RRS FAG R+ KRG ND G AN+VE E + Sbjct 357 LPIIHGYVDQAKIDVYGRLAYLTIIARRSRFFAGARFLKRGANDLGYVANDVETEQI--- 413 Query 70 TMPSRSASEAAALQAVAAAAAAAGTPAALWRQMLLRGGGAFEAAVASHVIARGSAPLMWC 129 SE + A A P S+V RGS PL W Sbjct 414 ------VSEMSETSFHAPGPALYANP-----------------LYTSYVQHRGSIPLYWT 450 Query 130 QDTTVIPSRPRIQ 142 QD + + +P I+ Sbjct 451 QDNSGVSPKPDIE 463 Lambda K H 0.322 0.130 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40