bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3330_orf1 Length=86 Score E Sequences producing significant alignments: (Bits) Value 4896.SPAC2C4.14c 77.8 9e-14 > 4896.SPAC2C4.14c Length=312 Score = 77.8 bits (190), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 42/82 (51%), Positives = 54/82 (65%), Gaps = 15/82 (18%) Query 1 IIAHLLKDVLSALVYLHGREVGPEGKIKKEVCIHRDLKAANILLSESGTAKLIDFGIS-- 58 +IA +++ VL ALVYLHG +GK+ HRD+KAANIL + G KL DFG+S Sbjct 103 VIAEVMRQVLEALVYLHG-----QGKM------HRDIKAANILTMKDGLVKLADFGVSGQ 151 Query 59 --VLSDKDEEFAGTPQWMAPEV 78 L DK+++F GTP WMAPEV Sbjct 152 LESLRDKNDDFVGTPFWMAPEV 173 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22443299781 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40