bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3322_orf1 Length=139 Score E Sequences producing significant alignments: (Bits) Value 5270.UM00716.1 84.3 1e-15 > 5270.UM00716.1 Length=399 Score = 84.3 bits (207), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 58/157 (36%), Positives = 79/157 (50%), Gaps = 30/157 (19%) Query 3 SSEAPQKKSLFVLFVGNLPLTVSAADVRSFFGRKLQLFIKDVRLLT-------------- 48 S+E + + F+LFVGN+ T ++ + FG+ + VRLLT Sbjct 152 SAETSARGNKFILFVGNMAFTTTSEYISKHFGQACGE-VPTVRLLTRKADPNALASLSAS 210 Query 49 -----------DKQTKKPKGCGFVEFTNKEALKIALNYDGRTLNERKIRVELTAGGGGKS 97 D + KGC FVEF EAL+ AL + L RKI VELTAGGGGKS Sbjct 211 KRKSIAKGKALDPTKPQSKGCAFVEFKTSEALRKALKFHHTLLEGRKINVELTAGGGGKS 270 Query 98 KIRAEKIKKKN----EERRKRRALLLKKKRDAAKRKT 130 + R EKIK+KN +ER+K + K +A K++T Sbjct 271 EARQEKIKEKNAGLEKERQKLHGKYVAPKNEARKQQT 307 Lambda K H 0.315 0.133 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23001752095 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40