bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3313_orf1 Length=148 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_3920 83.2 2e-15 > 5807.cgd2_3920 Length=1235 Score = 83.2 bits (204), Expect = 2e-15, Method: Composition-based stats. Identities = 51/144 (35%), Positives = 86/144 (59%), Gaps = 7/144 (4%) Query 5 INFHRTFVNRLQDEFERLQGKNVLLITEEERAECVEADDEAKLLKKKKTRVLGNMRFIGE 64 I F + + R + EF+ + + T+EER E ++++ A L +K+K VLG +R IGE Sbjct 1017 IAFSKALLARCEQEFKNMPRN--MTPTDEER-EKYDSEELAILYRKRKLHVLGIIRLIGE 1073 Query 65 LFLRRALSPNVLNDVVHALVFSSKGDAFPDEHFIECLTELLTTIGYTMDLQDSSRGMMNE 124 LF+R+ LN++V LV + PDE+ +ECL +L+ T GY +D + S+ ++++ Sbjct 1074 LFIRKMFPMRSLNELVFDLVMIQEN---PDEYAVECLCQLIMTTGYYLDSNEKSQMIVDQ 1130 Query 125 FIGKLQELQLRAGYSSRIVFKIQD 148 + G+L+ELQ S+R+ IQD Sbjct 1131 WFGRLRELQ-NTSISTRLNCLIQD 1153 Lambda K H 0.322 0.138 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40