bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3277_orf2 Length=127 Score E Sequences producing significant alignments: (Bits) Value 228410.NE1408 77.0 2e-13 > 228410.NE1408 Length=446 Score = 77.0 bits (188), Expect = 2e-13, Method: Composition-based stats. Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (0%) Query 1 ERAFRDSARSARQERLLAQVYLLMAAADVDDTGRLSFSDGPPESRLGLVGSRLYATVVDG 60 +RAF DSAR ++RL A++ +L+ +VD++G L ++ G V S +YA V Sbjct 28 DRAFYDSARIGVKDRLFARLLMLLGDTEVDESGELEIPTNLLDAEFGHVNSDIYAFVTGP 87 Query 61 AGKTVWHSHSDLADVRSANPILNPGMQSFGAIATANGDDYFVQSFGVRWNTPGGSFPFTF 120 A VW S S L +L G Q F I T + + YF+ + V W T G++P F Sbjct 88 ANTIVWRSTSSLNKPIPGITLLEKGKQEFEQI-TLDEEPYFIYRYSVAWETSSGNYPLIF 146 Query 121 SVAED 125 +V D Sbjct 147 NVMTD 151 Lambda K H 0.318 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22506847341 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40