bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3276_orf2 Length=85 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.78 68.6 5e-11 > 5833.MAL8P1.78 Length=172 Score = 68.6 bits (166), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 0/70 (0%) Query 1 GPRSKSELKEKFGSQLRLIAHERPTGYYCRRFQLPSNALEDTMTAQFNAGVLEVKFKCIQ 60 GPRS++EL E +G L L A ER GY+ R F+LP+N L+DT A + G+LE+K +C Q Sbjct 101 GPRSQTELFETYGDSLVLHAKEREVGYFKRIFKLPNNILDDTAKATYKNGILEIKMECKQ 160 Query 61 HQEKRRIDVG 70 + ++ + Sbjct 161 FSDMHKVTIN 170 Lambda K H 0.316 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22515314785 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40