bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3268_orf1 Length=72 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G13235.1 60.8 1e-08 > 3702.AT3G13235.1 Length=414 Score = 60.8 bits (146), Expect = 1e-08, Method: Composition-based stats. Identities = 22/45 (48%), Positives = 34/45 (75%), Gaps = 0/45 (0%) Query 3 ADKCSLASIIDKRFAGLTMGVGKAPIMGRVHVAPLKLGTKFCPCS 47 A++C L ++D+R+ G+ GVG+ I+GR+HVAP+K+G F PCS Sbjct 231 AERCGLLRLMDQRYKGIAHGVGQTEILGRIHVAPIKIGNNFYPCS 275 Lambda K H 0.324 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22573305356 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40