bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3247_orf1 Length=85 Score E Sequences producing significant alignments: (Bits) Value 51511.ENSCSAVP00000007729 74.3 9e-13 > 51511.ENSCSAVP00000007729 Length=1001 Score = 74.3 bits (181), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 37/85 (43%), Positives = 62/85 (72%), Gaps = 4/85 (4%) Query 1 TVEEKVLERANLKLQLDTAVIQQGRLHEGRQRQPEMSASALLKMVQFGAEYIFKPAQQNE 60 TVEE+++ERA +KL LD VIQQGRL + Q+ ++ +L+M++ GA ++F ++++E Sbjct 564 TVEERIMERAEMKLHLDNIVIQQGRLVDQSQK---LAKDEMLQMIRHGANHVFA-SKESE 619 Query 61 LTEEELDAILARGQERTEQMHAMLQ 85 +T+E++DAI+A G+ RT +M LQ Sbjct 620 ITDEDIDAIIAHGESRTNEMKQRLQ 644 Lambda K H 0.314 0.128 0.332 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22515314785 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40