bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3180_orf1 Length=153 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1335c 137 7e-32 > 5833.PFF1335c Length=189 Score = 137 bits (346), Expect = 7e-32, Method: Compositional matrix adjust. Identities = 70/153 (45%), Positives = 100/153 (65%), Gaps = 1/153 (0%) Query 1 ALVILANGAEDIEFASPVDVLRRAGVKVVVASLGEGLIVKTAQGLRIEGDMPLEDVSPDA 60 ALV +A+G+ED+E+ + VDVLRRAGV V AS+ + V + D + V + Sbjct 7 ALVAVASGSEDVEYITVVDVLRRAGVHVTTASVEKSEQVCLQSKNVVLADTTISKVRNNI 66 Query 61 HYDVIVLPGGLKGAENCRDSAHLASLLKQQHAAGRWIAAICASPALVLTHHGLLENINSV 120 YDV+V+PGG+KG+ + + +LK+Q A R AAICA+P VL H L++++ +V Sbjct 67 -YDVLVIPGGMKGSNTISECSEFIDMLKEQKANNRLYAAICAAPETVLDRHSLIDDVEAV 125 Query 121 AYPSFMSHIKHKGEGRVCVDKHYITSIGPGSAM 153 AYPSF + KH G+GRVCV K+ ITS+GPGSA+ Sbjct 126 AYPSFERNFKHIGKGRVCVSKNCITSVGPGSAV 158 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23213563385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40