bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3134_orf2 Length=144 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP000178-PA 64.7 7e-10 > 7165.AGAP000178-PA Length=1321 Score = 64.7 bits (156), Expect = 7e-10, Method: Composition-based stats. Identities = 42/115 (36%), Positives = 62/115 (53%), Gaps = 6/115 (5%) Query 32 AMLASSGGDAGDAAALLERR--AIAAREDMYRRQRFQRALSPERQDPFAADGGRRADVSA 89 A+L G + D ERR +A +ED YR++R + +SPER DPFA DGG+ DV + Sbjct 94 ALLNEMGQVSMDYDPFAERRKPTVAEKEDEYRQKRRRLVISPERVDPFA-DGGKTPDVGS 152 Query 90 RSYADVMVEQQLDREKQAAVKQIRKLQEDAAIAQQLLQQRQQEEAAGGAAAGKRG 144 RSY ++M EQ L E+ K+I++ +D ++ + Q A KRG Sbjct 153 RSYTEIMREQMLKGEEAELRKKIQEKAKDGSLK---INSTAQAAKPAPVEAKKRG 204 Lambda K H 0.314 0.128 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22567178795 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40