bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3076_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value 5833.PF08_0045 67.8 9e-11 > 5833.PF08_0045 Length=1038 Score = 67.8 bits (164), Expect = 9e-11, Method: Composition-based stats. Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 0/81 (0%) Query 29 EGSSQSVHDTSRLIQMVRGYQMIGHELAAINPLSLPRKPPYCSLRAAQQPLQLGPEHYGF 88 +G +++++D +R++Q++R YQ GH A INPL LP++PPY S+ ++ +GF Sbjct 115 KGKTENIYDLARIVQLIRWYQKKGHLYANINPLPLPKEPPYSSVCYEPCKRKMSYVDFGF 174 Query 89 TAADFDKVYVARVPGMQGFLS 109 D DK + +P + GF S Sbjct 175 NEDDLDKEFFFDLPSISGFSS 195 Lambda K H 0.314 0.130 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23016794144 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40