bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3072_orf2 Length=160 Score E Sequences producing significant alignments: (Bits) Value 7227.CG5823-PA 139 2e-32 > 7227.CG5823-PA Length=283 Score = 139 bits (351), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 61/126 (48%), Positives = 88/126 (69%), Gaps = 1/126 (0%) Query 30 SSSSSSSKMSSKGAVDRLRREWKSLQRESLPNVEARPQEDDFLTWIFLIHDLPEDSSFAG 89 SSSS+S AV R+++++ L+R+ LP + A P ++ L W + + PEDS + G Sbjct 2 SSSSTSGGRKQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKG-PEDSPYYG 60 Query 90 GFYMGKVVFPATYPFSPPSIYMLTPNGRFETNRSLCVSFTHYHPELWNPSWKVETLLTGF 149 G+Y G ++FP +PF PPSIYMLTPNGRF+TN LC+S + +HP+ WNP+W V T+LTG Sbjct 61 GYYHGTLLFPREFPFKPPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGL 120 Query 150 VSFMLD 155 +SFML+ Sbjct 121 LSFMLE 126 Lambda K H 0.314 0.127 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26871144147 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40