bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3057_orf2 Length=74 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_1430 97.8 9e-20 > 5807.cgd7_1430 Length=463 Score = 97.8 bits (242), Expect = 9e-20, Method: Composition-based stats. Identities = 42/74 (56%), Positives = 54/74 (72%), Gaps = 0/74 (0%) Query 1 LGVGYEYEADVLGEEQWGWLEAQLKHSRAQAHIVVSSIQVLTGLPLVESWGLFPVSRLRL 60 G G+ Y+ D+LG+EQW WLE +L +S+A A+I++SSIQV T P+VE WG FP SR RL Sbjct 211 FGYGHSYQGDMLGKEQWDWLEKELSNSKALANIIISSIQVTTQYPIVEGWGHFPKSRERL 270 Query 61 LSLFARTKPKGLML 74 SL +TKPKGL Sbjct 271 FSLIKKTKPKGLFF 284 Lambda K H 0.321 0.138 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22434241900 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40