bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3002_orf1 Length=142 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G05970.1 127 7e-29 > 3702.AT3G05970.1 Length=701 Score = 127 bits (320), Expect = 7e-29, Method: Composition-based stats. Identities = 61/139 (43%), Positives = 88/139 (63%), Gaps = 1/139 (0%) Query 1 VFKLAHGEYIAPERLENIYSASRWVEQIFVYGDSLEAVLVAIIVPSPTEVRKWAEKNNKA 60 +FKLA GEYIAPE++EN+Y+ ++V Q F+YGDS + LVA++ P ++ WA Sbjct 552 IFKLAQGEYIAPEKIENVYAKCKFVGQCFIYGDSFNSSLVAVVSVDPDVLKSWAASEGIK 611 Query 61 GEPMEALLKDEALKAEILKDLELLGR-AQLKGFELIRAIWLTDDTFTPENGLLTPTMKLI 119 G + L + +KA +L D++ +GR AQL+GFE +A+ L + FT ENGLLTPT K+ Sbjct 612 GGDLRELCNNPRVKAAVLSDMDTVGREAQLRGFEFAKAVTLVLEPFTLENGLLTPTFKIK 671 Query 120 RHAAKNRFIKEIKELYSSL 138 R AK F + I +Y L Sbjct 672 RPQAKEYFAEAITNMYKEL 690 Lambda K H 0.318 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22741008115 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40