bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2991_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_310 152 3e-36 > 5807.cgd5_310 Length=813 Score = 152 bits (383), Expect = 3e-36, Method: Composition-based stats. Identities = 68/133 (51%), Positives = 93/133 (69%), Gaps = 2/133 (1%) Query 18 WKPPDSFVRVTTKYWVRPENIVRAQCLIVRHLPFLVFGTSDKDLEASLLGPEATANGHNF 77 WKPP++F+R TTKYWV P N+V A+ I+R++P+L+FG S+ +LE +LL P GHN Sbjct 269 WKPPETFLRNTTKYWVHPNNVVSAKVGIIRYVPYLIFGISNSELE-TLLDPYMCVEGHNV 327 Query 78 RGP-NLAPTQMVASVYFDSSSAYSYERRIRRFEGAQLLRFRWYGTNNDGPDEDIFIERKT 136 P + +Q + SVY D+ +A Y RI RFE AQL R RWYG+N+ +++IF+ERKT Sbjct 328 VDPKTIEESQAITSVYLDNMNAECYYNRISRFEDAQLFRLRWYGSNSGSKEKEIFMERKT 387 Query 137 HHESWSGMSSTKE 149 HHESW+G S KE Sbjct 388 HHESWTGEKSAKE 400 Lambda K H 0.319 0.134 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40