bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2985_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value 5207.CNA07120 88.2 6e-17 > 5207.CNA07120 Length=353 Score = 88.2 bits (217), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 44/86 (51%), Positives = 59/86 (68%), Gaps = 1/86 (1%) Query 30 LEYRNELLKRDPKVNYLMTLYLCPDVDPHDLAKNAKASHVVGVKLYPRGVTTNSEAGVED 89 L Y+ EL K DP V +LMTLYL PDV P ++ K AKA + GVK YPRGVTTNS +G+ED Sbjct 55 LSYKAELEKIDPSVQWLMTLYLHPDVTPAEIRKAAKAG-IKGVKSYPRGVTTNSSSGIED 113 Query 90 LTAFDGVFEALQRCGLSLHIHAESPT 115 + VF+A++ + L++H E P+ Sbjct 114 YEVYYPVFKAMEEEDMVLNLHGEVPS 139 Lambda K H 0.316 0.130 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40