bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2961_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0108 157 6e-38 > 5833.PF11_0108 Length=1329 Score = 157 bits (398), Expect = 6e-38, Method: Composition-based stats. Identities = 78/123 (63%), Positives = 97/123 (78%), Gaps = 1/123 (0%) Query 1 ARELISLGCQRCPKSEDVWLEAARLE-KPRNAKAVLAKAVSVLPHSVRLWLDAYAREKDI 59 A+E+I GC C K+ED+WLEA RLE K K +LAKA+ +P SV+LWL+AY +EK++ Sbjct 443 AKEIIMKGCVVCSKNEDIWLEAVRLEEKLSEVKIILAKAIKHIPTSVKLWLEAYKKEKNV 502 Query 60 NDRRLVLRKALEFIPNSVRLWKEACSLEDERNARILLTRAVECVSQSHEMWLALARLSTY 119 +D+R VLRKA+E IPNSV+LWKEA SLE+E NA ILL RAVEC+ QS EMW+ALARL TY Sbjct 503 DDKRKVLRKAIECIPNSVKLWKEAISLENENNAYILLKRAVECIPQSIEMWIALARLCTY 562 Query 120 EEA 122 EA Sbjct 563 TEA 565 Lambda K H 0.320 0.131 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40