bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2944_orf1 Length=134 Score E Sequences producing significant alignments: (Bits) Value 5833.PF10_0232 158 4e-38 > 5833.PF10_0232 Length=3328 Score = 158 bits (400), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 79/132 (59%), Positives = 97/132 (73%), Gaps = 1/132 (0%) Query 1 LHFLNPSIHRSFEEFRHRYYLVERHSEVGEIKTKQLAALQQELNGYILRRVKKDVERSMP 60 LHFLNP + +E F+ +Y +E S +GE K KQL LQ EL+ ILRRVKKDVE+S+P Sbjct 1478 LHFLNPQQYTYYETFQKKYNEIENTSLIGEAKQKQLIQLQHELHEVILRRVKKDVEKSLP 1537 Query 61 KKVESILRVEMSPLQLYFYKLILTKNYELLARKGGSNRASLQNICMELKKVCNHPFLCQA 120 KVE ILRVE+SP+Q+ +YK ILTKNYE LA+ G + SLQNICMELKKVCNHPFLC Sbjct 1538 NKVERILRVELSPIQIEYYKNILTKNYEQLAKASGGAKNSLQNICMELKKVCNHPFLCAE 1597 Query 121 P-NTPEQRNRLL 131 P + E + RL+ Sbjct 1598 PLDKDEYKERLV 1609 Lambda K H 0.322 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682284714 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40