bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2878_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE1415w 71.6 6e-12 > 5833.PFE1415w Length=406 Score = 71.6 bits (174), Expect = 6e-12, Method: Composition-based stats. Identities = 40/94 (42%), Positives = 55/94 (58%), Gaps = 1/94 (1%) Query 29 FLLLLFYGAATCLFVAATIAESVLAAVAEPKVEFNVLFLLLLGSILDIFLFAVVFLFGAF 88 F+L L Y + T +FV+ T+ SV A+ + FN +FLLL G L+ FL +V F F Sbjct 261 FMLSLIYCSITTVFVSITMFTSVRNAIKNGETPFNEMFLLLFGETLNSFLSLIVTCFLFF 320 Query 89 HTYLLAKGMTTIEFCEKRFRRSQHQPPANMWNLG 122 H +LL MTTIEFCEK+ Q+Q + +N G Sbjct 321 HIWLLINAMTTIEFCEKQ-TNYQNQSYSKYYNKG 353 Lambda K H 0.335 0.145 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40