bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2866_orf1 Length=95 Score E Sequences producing significant alignments: (Bits) Value 1140.Synpcc7942_0830 119 2e-26 > 1140.Synpcc7942_0830 Length=462 Score = 119 bits (299), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 59/94 (62%), Positives = 70/94 (74%), Gaps = 6/94 (6%) Query 2 VESPADGQKIELQVADPQRGDSVEVLGGADAGKYPLAKKEHSREYLREIAHLRPRTQLIG 61 V SPA GQ++ELQ A SVE++GGAD +YPL KK HS E+LR IAHLRPRT +G Sbjct 79 VASPAKGQRVELQAA------SVEIVGGADPEQYPLQKKRHSFEFLRTIAHLRPRTNSLG 132 Query 62 AVARVRSQLAMATHRFFQDRGFLYVHTPIITTAD 95 AV RVR+ A A H FFQ+RGFL+VHTPIIT +D Sbjct 133 AVMRVRNAAATAIHDFFQERGFLWVHTPIITASD 166 Lambda K H 0.321 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22621220430 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40