bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2855_orf2 Length=120 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000004850 68.6 6e-11 > 69293.ENSGACP00000004850 Length=1056 Score = 68.6 bits (166), Expect = 6e-11, Method: Composition-based stats. Identities = 40/114 (35%), Positives = 60/114 (52%), Gaps = 7/114 (6%) Query 8 NHFALP-QANLHANTFSLVAHPFVLDASAKAEIIRMQATLEQQHQARQAEVQALLSLCRG 66 NH LP + H +L +PFV DA AK +++ A ++ Q QA++Q S+ Sbjct 640 NHLFLPLYSQGHDGVVTLCRYPFVFDAQAKTTLLQTDAVIQMQMAVDQAQMQNFSSMFLP 699 Query 67 GIGSPLPFLYLRVRRTHLVEDTLQQIASSSNSSSSTRTDLRKALKVKFIGEEGI 120 + S P L L VRR ++V DT++ + S N D +K LKV F+GEE + Sbjct 700 AVESVNPCLILIVRRENIVGDTMEVLRKSKN------VDYKKPLKVIFVGEEAV 747 Lambda K H 0.319 0.129 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40