bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2834_orf1 Length=177 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0215c 118 9e-26 > 5833.PFI0215c Length=185 Score = 118 bits (295), Expect = 9e-26, Method: Compositional matrix adjust. Identities = 60/170 (35%), Positives = 98/170 (57%), Gaps = 2/170 (1%) Query 3 MENYLNRANAVFCSLMVSLGVLALGNIASSFFLVGP--ISGSVSAREVYGFGYNYALSGD 60 M+++LNR N +F S+ + +L N +SF+L I ++ + + F YN ++ D Sbjct 1 MDSFLNRLNVLFYSMALCFLILCAFNYGTSFYLFDEKEIKTNIQVKSIKRFVYNRYINAD 60 Query 61 QAVLSFDIKADLRGLFQWNAKQLFVFVVAEYESPQHPTNQVVVFDRIITNESEAVLDLAN 120 +AVLS D+ D+R F WN KQLFV+V+ YE+P+ N+V++ D I+ N+ +A + N Sbjct 61 EAVLSLDVSYDMRKAFNWNLKQLFVYVLVTYETPKKIKNEVIIQDYIVKNKKQAKKNYRN 120 Query 121 VPAKYHLRDKGKGLRGREITLKLQVVYHPIVGRIYTQTVASSTFRMPAQY 170 KY L+D GLR I L++ Y PIVG + A ++++P +Y Sbjct 121 FITKYSLKDYYNGLRNNLIHLQVCYKYMPIVGFSRSFEGAKISYQLPPEY 170 Lambda K H 0.322 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35195248557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40