bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2822_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0190552 140 1e-32 > 44689.DDBDRAFT_0190552 Length=206 Score = 140 bits (353), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 64/107 (59%), Positives = 82/107 (76%), Gaps = 1/107 (0%) Query 5 MVFTYQCSTPGYEIYMGRDKYENEDLIVHAFPEDVWFHVSELSSAHVYVRMPFGQTDYES 64 MV ++ P Y YMG DK+ENEDLI + +PEDVWFHV++LSSAHVY+R+ G+T + Sbjct 1 MVLYFKLIDPEYICYMGIDKFENEDLIKYGWPEDVWFHVNDLSSAHVYLRLRKGET-WND 59 Query 65 LPAEVIEEACQLTKYNSIEGCKQSEVTIVYTPASNLKKTASMETGQV 111 +PA ++EE CQL K NSI+GCK++ V IVYTP +NLKKTA ME GQV Sbjct 60 IPANILEECCQLVKQNSIQGCKEASVDIVYTPWANLKKTAGMEAGQV 106 Lambda K H 0.315 0.130 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23016794144 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40