bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2790_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_3000 203 1e-51 > 5807.cgd4_3000 Length=702 Score = 203 bits (517), Expect = 1e-51, Method: Composition-based stats. Identities = 93/152 (61%), Positives = 120/152 (78%), Gaps = 3/152 (1%) Query 1 MENVARVNYSRPTPIQKNSIPTILAGRDLMACAQTGSGKTAAFLYPIIAQMLQTGPPALP 60 ++N+ RV Y RPTP+QK SIPT+L GRDLMACAQTGSGKTAAFL+PI+ +ML GPP P Sbjct 213 LDNIRRVKYERPTPVQKFSIPTVLNGRDLMACAQTGSGKTAAFLFPIVMKMLNDGPPPTP 272 Query 61 ASERGSTSAYRRSVFPVCLVLSPTRELAMQIYQEARKFQFGTGIRTVPVYGGSQIKRQLM 120 + S+ +R +PV LVLSPTRELA+Q Y+E+RKF FGTGIRT +YGGS+++ Q+M Sbjct 273 ---QQSSLRIKRMAYPVALVLSPTRELAIQTYEESRKFCFGTGIRTNVLYGGSEVRSQIM 329 Query 121 DLDAGCDICVATPGRLADVLERRKIRLALVRY 152 DLD G DI VATPGRL D+++R K+ L L+++ Sbjct 330 DLDRGSDIIVATPGRLRDLIDRGKVNLKLIKF 361 Lambda K H 0.323 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40