bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2775_orf1 Length=112 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0652 103 1e-21 > 5833.PF14_0652 Length=862 Score = 103 bits (258), Expect = 1e-21, Method: Composition-based stats. Identities = 46/101 (45%), Positives = 58/101 (57%), Gaps = 13/101 (12%) Query 1 FRTKACLRLVQGSCSFGDDRCQYSHSQVWTRRSPYYAPPGSRVDRQELGQRQQPLLRYLP 60 FRTK C RL+ G C+FG DRCQYSH++ W RR P+Y S +RY+ Sbjct 15 FRTKQCKRLLNGGCNFGLDRCQYSHNEFWNRRCPFYLSDSS-------------FIRYIT 61 Query 61 VLCQNLQIEDGRLIKVKCPRGVNCPFSHSPEEIAYHPLVYK 101 V+C +++ I C RG CPF+HS EEI YHPL YK Sbjct 62 VMCPDVETRGDGSINSLCLRGGECPFAHSTEEILYHPLFYK 102 Lambda K H 0.323 0.138 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40