bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2743_orf1 Length=136 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_140 107 7e-23 > 5807.cgd4_140 Length=1278 Score = 107 bits (268), Expect = 7e-23, Method: Composition-based stats. Identities = 55/114 (48%), Positives = 69/114 (60%), Gaps = 2/114 (1%) Query 20 LTKREIKGRVASPEGLLLPLLPFQEEGLWWLTQQEASHIKGGILADEMGMGKTIQIISLL 79 L R I +P L LL FQ+EGL WL QE S +GGILADEMGMGKTIQ ISL+ Sbjct 166 LISRSIVEVKPTPIKLTYELLQFQKEGLAWLCNQEKSTARGGILADEMGMGKTIQTISLI 225 Query 80 LSRPLPTIPESAPPLVRACVCSTLIVTPLAALLQWKSELDKFVAPGRLSVLIYH 133 L +P + A + L++ P+AA+LQWK E+++F PG L V IYH Sbjct 226 LEHDIPPVTNKAEK--GEVIGKNLVIAPVAAVLQWKQEIERFTKPGSLKVHIYH 277 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22513421946 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40