bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2690_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 13616.ENSMODP00000029745 160 8e-39 > 13616.ENSMODP00000029745 Length=426 Score = 160 bits (406), Expect = 8e-39, Method: Compositional matrix adjust. Identities = 73/118 (61%), Positives = 96/118 (81%), Gaps = 0/118 (0%) Query 3 RGKMAFKKVVVINCQGHLLGRLASTVAKEIQNGQHVVCVKCENINISGSLHRNKLKYQAF 62 RG++ + V+VI+ +GHLLGRLA+ VAK++ G+ VV V+CE INISG+ +RNKLKY AF Sbjct 221 RGRVTWPGVLVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAF 280 Query 63 LRLRMNSNPRRGPYHMRAPSRIFWRAVRGMIRHKTIRGKKALSRLEVYEGVPVKYERK 120 LR RMN+NP RGPYH RAPSRIFWR VRGM+ HKT RG+ AL RL+V++G+P Y+++ Sbjct 281 LRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKR 338 Lambda K H 0.325 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40