bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2664_orf1 Length=172 Score E Sequences producing significant alignments: (Bits) Value 368408.Tpen_1284 62.4 5e-09 > 368408.Tpen_1284 Length=870 Score = 62.4 bits (150), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 16/159 (10%) Query 3 AVDSRGNTALHYAA------SFNSYTATLRLLEKAELALSNINQANYRGKAPIHLAAAPV 56 A +S G T LHY A S N++ LR+ E + +++N + R + P+H+A V Sbjct 719 ARNSHGETPLHYVAEHADMCSKNAWDNCLRIAELLLIHGADVNARDSRDQTPLHIA---V 775 Query 57 SFQAVPRPIVPALALEALLVHHANPMARDKSGNTPLHLAAQGGYVEIVRRLVALT---GA 113 F + V LE H A+P ARD GNTPLH + + R + L GA Sbjct 776 FFGSREHLEVARWLLE----HGADPNARDWEGNTPLHYVIEHSFWRERREAIELLLEHGA 831 Query 114 PPDEKNAEGLTPLAMVEKAGKGPGREEITQFLRVYSQKR 152 P +N+EGL+PL + G ++ ++ + + R Sbjct 832 DPSIRNSEGLSPLQLAVIKGDTDAFALLSGYMFRFRKTR 870 Lambda K H 0.317 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32857020181 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40