bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2642_orf2 Length=98 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0540 115 3e-25 > 5833.PF14_0540 Length=684 Score = 115 bits (289), Expect = 3e-25, Method: Composition-based stats. Identities = 54/93 (58%), Positives = 72/93 (77%), Gaps = 0/93 (0%) Query 1 LHLIADMLELVSQSDPSNSGSLKLCKAILRGLENILEVGVQEGKSLDLPENPYARLFQAV 60 + LIADMLELVS+SDP N+GS+KLCK+ILRGLENIL+ G E + L L ENPY +F+ V Sbjct 586 MQLIADMLELVSESDPMNNGSVKLCKSILRGLENILDKGDDETRDLSLWENPYVFMFKEV 645 Query 61 QGDVKLARMRYFPDYNVATKAHSILQYFTTLSS 93 QGD+KL +M++FP+Y V K + IL + +L+S Sbjct 646 QGDIKLLQMQFFPEYYVVNKTYDILAKYFSLTS 678 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22397725590 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40